KEGG   Hydra vulgaris: 100214470Help
Entry
100214470         CDS       T01080                                 

Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
hmg  Hydra vulgaris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100214470
Messenger RNA biogenesis [BR:hmg03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100214470
Translation factors [BR:hmg03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100214470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 694 aa AA seqDB search
MVGIMAADEYSSYDNRIDNGYDSEEDFIDDTQFEDPEGFVDPMTEEELVGDILEQRPKES
DSLDTVIIVDNVPIVGPDRLEKLKSMIHKVFSSFGTIVNDYYPEENGKTKGYIFLEFPKA
EDAANAIKTANGYRLDKNHTFAVNSFNDFEKYKDISTDWVPPEKRVFNDFGNLKSWLLEP
DSNDQYSMMTGNGERVVILQNGPTAPTVIKQRDNWTESYVMWSPKGTYMATIHKQGVVLW
GGEEFARINRFNHTNVSLIDFSPCERYLVTFSANHMNNQEPAIVIWDILTGMKKRDFVAG
GTWPVFKWSPDGSMVARSNGENLSIYESPNFVLLEKKSIKIPGLMDFSWSPKQNIIAYWV
PEDKDTPARLCIMHLPSKKEIRVKNLFNVQDCKMFWQKSGDYLCVKVERLTKSKKRIYYN
LELFRMNEKNVPVDTLELKDTISTFEWEPTGNKFCIIHGESPRISASFYQIESSQLGNVT
LIKQFENKSCNAISWCPNGQFCVLAGLRNLNGSLEFIDTSDMTIMNSGEHFMASDIEWDP
TGRYFMSGVSWWTHKVDNGYFIWSFQGKILQRHVLNQFSHFAWRPRPPTLLTEADIERVK
KGLKKYQKMFEIKDRMSQTKASKELIEKRRALHDHFSGFRKRHDETFEDYKMLRLQLREG
VDTDSLESQYGDVEEETIEFFIREDIEIIDTKEE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggtggggatcatggcggctgatgaatattcctcttacgataatcgtattgataatggt
tatgattctgaagaagattttattgatgatacacaatttgaagatcctgaaggatttgtc
gatcctatgacagaagaagagttagttggggatatccttgaacaacgaccaaaagaaagt
gatagtcttgatacagttataattgtagacaatgtcccaattgttggacctgatcgtctt
gagaaacttaaaagtatgattcataaagttttttcaagctttggaaccattgtgaatgac
tattatccagaagaaaatggaaaaactaaagggtacatttttcttgaatttccaaaagca
gaagatgcagctaatgctattaaaactgccaatgggtaccgacttgacaaaaatcacaca
tttgctgttaattcctttaatgattttgaaaaatacaaagatatttcaactgactgggtt
cctccagaaaaacgagtgtttaacgattttggaaatttaaaatcttggttacttgaacca
gatagtaatgatcaatattcaatgatgactggaaatggggaacgggttgttattttacaa
aatggtccaactgctccaacagttattaagcaaagagataactggactgagtcatatgtg
atgtggtcacctaaaggaacttatatggctacaattcataagcaaggtgttgttttatgg
ggtggtgaagaatttgcaagaatcaacagatttaatcatactaatgtttccctgattgat
ttttcaccatgtgaacggtatttagttaccttttcagccaatcatatgaacaatcaagaa
cctgctattgtcatttgggatattttgactggtatgaagaagagagattttgttgctggt
ggaacatggccagttttcaaatggagtcctgacggtagtatggtggcaagatctaatgga
gaaaatcttagtatttatgagtcacctaattttgttctacttgagaaaaaaagcattaaa
ataccaggtttaatggacttttcatggtcacctaaacaaaacataattgcttattgggtt
cctgaagataaagatactccagcaagactttgcattatgcatttacctagcaaaaaggag
atacgtgttaaaaatctttttaatgttcaggattgtaaaatgttttggcaaaaaagtggt
gactatctctgtgttaaagttgaaaggcttacaaagagtaaaaagagaatatattataac
ctggaattattcagaatgaatgaaaagaatgtgcctgttgatacattagagcttaaagat
actattagcacctttgagtgggaacctacaggtaataaattttgcatcatacatggtgaa
agtcctcgtatttcagcaagcttttatcaaattgagtcatctcagcttggaaatgttaca
ctcatcaagcaatttgaaaacaaatcatgtaatgctatatcctggtgtccaaatggacaa
ttctgtgtattagctggtttgagaaatttaaatggtagtctggaattcatagatacatct
gatatgactattatgaactcaggtgaacattttatggctagtgatattgaatgggatccc
actgggcgatattttatgagtggtgtaagttggtggactcacaaagttgacaatggttat
tttatttggtcttttcaaggcaaaattttgcaacgccatgttttgaatcaatttagccat
tttgcatggcgtcctcgaccacctacccttcttactgaagcggatatagaaagagttaag
aagggtttgaagaaataccagaagatgtttgaaattaaagatagaatgtcacaaacaaaa
gcctcaaaagaacttattgaaaaacggcgcgctttacatgatcatttctctggatttcgg
aaacgccatgatgagacatttgaagattacaaaatgcttagacttcagttacgagaaggt
gttgatacagatagtttggaaagtcagtatggcgacgttgaggaagaaacaattgagttc
tttattcgagaagacatcgaaattattgacaccaaagaggagtga

DBGET integrated database retrieval system