KEGG   Hydra vulgaris: 100214734Help
Entry
100214734         CDS       T01080                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hmg  Hydra vulgaris
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100214734
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100214734
   00020 Citrate cycle (TCA cycle)
    100214734
   00620 Pyruvate metabolism
    100214734
Enzymes [BR:hmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100214734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 527 aa AA seqDB search
MSVSAFICRVARSRVGFFQHKNTKSIIFITTEIQKLQNSNSNFELSRNICSSASPFSHKR
LFTSCWENQGRLNDMSIKRNYATMPPHEKVLLPNLSPTMTTGTIVSWEKKVGDKINEGDV
LALIETDKSTMEMETPEPGYLAKIIVPVGTRDVAINQLIAIIVSNEEDLDAFKNYTGEET
TKTLDAKLDASPSTVASHSPPVVEEPPPPSSTNRVFASPLAKRVALEKGIDINNVVGSGP
RGRITVADIENFKTPLIAPKIEKVTAAPISKQPSPELQSTPSVFQPSLVQPPVAEGVMFK
DIPLSNMRKTIAKRLTESKQTVPHYYLTSEINMDKVFELRSQLNAESLGAFKLSINDFVI
KAAALSLRKVPECNSQWFSEYIRQFENVDVSVAVSIDGGLITPIVKDADKKGLTAISADV
VALANKARDKTIQPHEFLGGTFTVSNLGMYGISNFSAVINPPQSCILAVSASEDRVVPDQ
TSETRMKISKMMSVTLSCDHRVVDGAVGAAWLKTFRGYLEKPITMLL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatcagcttttatatgcagagttgctcgcagtagagttggtttctttcaacac
aaaaatacaaaaagcattatttttattacaactgaaattcaaaaactacaaaattcaaat
agtaattttgagttatccagaaatatatgcagttctgcttctccattttcccacaaaagg
ttgttcacatcatgctgggaaaatcaaggaaggttaaatgacatgtctataaaaagaaat
tatgccacaatgccacctcatgaaaaagtattgttgcccaatttatctccaactatgaca
acaggaacaattgtttcttgggagaaaaaagttggggataaaattaatgaaggtgatgtg
cttgcattaattgaaactgataaatctactatggaaatggagactccagagccaggctat
cttgctaaaattattgttccagttggaacaagagatgttgctattaatcagttaattgct
ataattgttagtaatgaagaggacttggatgcatttaaaaactatactggagaagagacc
acaaaaactcttgatgcaaagcttgatgcttcaccttcaacagttgccagccattcacct
ccagtagttgaagaacctccaccaccatcttctacaaaccgtgtatttgctagcccactt
gctaaacgtgttgccttggaaaaaggaattgatataaataatgttgttggatcaggccct
cgaggaagaattactgtagctgatattgaaaatttcaaaacccctcttattgctccaaaa
attgaaaaagttacagctgctccaatttctaaacagccatccccagaattgcaaagcacg
ccatctgtattccagccctcattggttcagccaccagtggctgaaggtgtaatgtttaaa
gacatacctttatcaaatatgaggaaaacaatagccaagcggttaactgagtcaaagcaa
actgtgcctcactattatttaacttctgaaatcaacatggataaagtttttgagttgcga
tctcaactcaatgctgaaagccttggagcttttaaactttctataaatgattttgtaatt
aaagctgcagcattatctcttcgcaaagtgccagaatgcaactctcaatggttttctgag
tacattcgtcaattcgaaaatgtggatgtgagtgttgcagttagtatcgacggtggtctt
attacgccaatagtcaaagatgctgataaaaagggtttaacggctatcagtgctgatgtt
gttgcattggcaaacaaagctcgagataaaacaattcagccgcatgaatttttgggagga
acatttactgtgtcaaacttagggatgtatggcataagtaatttctcggctgtcatcaac
cctccgcagagttgcattctagcagttagtgcatcggaagatcgtgttgttccagatcaa
accagtgaaactcgaatgaaaatttcaaaaatgatgagtgtaacgttaagctgcgatcat
cgtgttgtcgacggagcagttggagccgcttggttgaaaacattccgtggttatctggaa
aaaccaattacaatgcttttgtaa

DBGET integrated database retrieval system