KEGG   Hydra vulgaris: 100214734Help
Entry
100214734         CDS       T01080                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hmg  Hydra vulgaris
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:hmg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hmg00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hmg00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hmg00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 527 aa AA seqDB search
MSVSAFICRVARSRVGFFQHKNTKSIIFITTEIQKLQNSNSNFELSRNICSSASPFSHKR
LFTSCWENQGRLNDMSIKRNYATMPPHEKVLLPNLSPTMTTGTIVSWEKKVGDKINEGDV
LALIETDKSTMEMETPEPGYLAKIIVPVGTRDVAINQLIAIIVSNEEDLDAFKNYTGEET
TKTLDAKLDASPSTVASHSPPVVEEPPPPSSTNRVFASPLAKRVALEKGIDINNVVGSGP
RGRITVADIENFKTPLIAPKIEKVTAAPISKQPSPELQSTPSVFQPSLVQPPVAEGVMFK
DIPLSNMRKTIAKRLTESKQTVPHYYLTSEINMDKVFELRSQLNAESLGAFKLSINDFVI
KAAALSLRKVPECNSQWFSEYIRQFENVDVSVAVSIDGGLITPIVKDADKKGLTAISADV
VALANKARDKTIQPHEFLGGTFTVSNLGMYGISNFSAVINPPQSCILAVSASEDRVVPDQ
TSETRMKISKMMSVTLSCDHRVVDGAVGAAWLKTFRGYLEKPITMLL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatcagcttttatatgcagagttgctcgcagtagagttggtttctttcaacac
aaaaatacaaaaagcattatttttattacaactgaaattcaaaaactacaaaattcaaat
agtaattttgagttatccagaaatatatgcagttctgcttctccattttcccacaaaagg
ttgttcacatcatgctgggaaaatcaaggaaggttaaatgacatgtctataaaaagaaat
tatgccacaatgccacctcatgaaaaagtattgttgcccaatttatctccaactatgaca
acaggaacaattgtttcttgggagaaaaaagttggggataaaattaatgaaggtgatgtg
cttgcattaattgaaactgataaatctactatggaaatggagactccagagccaggctat
cttgctaaaattattgttccagttggaacaagagatgttgctattaatcagttaattgct
ataattgttagtaatgaagaggacttggatgcatttaaaaactatactggagaagagacc
acaaaaactcttgatgcaaagcttgatgcttcaccttcaacagttgccagccattcacct
ccagtagttgaagaacctccaccaccatcttctacaaaccgtgtatttgctagcccactt
gctaaacgtgttgccttggaaaaaggaattgatataaataatgttgttggatcaggccct
cgaggaagaattactgtagctgatattgaaaatttcaaaacccctcttattgctccaaaa
attgaaaaagttacagctgctccaatttctaaacagccatccccagaattgcaaagcacg
ccatctgtattccagccctcattggttcagccaccagtggctgaaggtgtaatgtttaaa
gacatacctttatcaaatatgaggaaaacaatagccaagcggttaactgagtcaaagcaa
actgtgcctcactattatttaacttctgaaatcaacatggataaagtttttgagttgcga
tctcaactcaatgctgaaagccttggagcttttaaactttctataaatgattttgtaatt
aaagctgcagcattatctcttcgcaaagtgccagaatgcaactctcaatggttttctgag
tacattcgtcaattcgaaaatgtggatgtgagtgttgcagttagtatcgacggtggtctt
attacgccaatagtcaaagatgctgataaaaagggtttaacggctatcagtgctgatgtt
gttgcattggcaaacaaagctcgagataaaacaattcagccgcatgaatttttgggagga
acatttactgtgtcaaacttagggatgtatggcataagtaatttctcggctgtcatcaac
cctccgcagagttgcattctagcagttagtgcatcggaagatcgtgttgttccagatcaa
accagtgaaactcgaatgaaaatttcaaaaatgatgagtgtaacgttaagctgcgatcat
cgtgttgtcgacggagcagttggagccgcttggttgaaaacattccgtggttatctggaa
aaaccaattacaatgcttttgtaa

DBGET integrated database retrieval system