KEGG   Hydra vulgaris: 100214984Help
Entry
100214984         CDS       T01080                                 

Definition
3-methyl-2-oxobutanoate dehydrogenase [lipoamide] kinase-like
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     100214984
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100214984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 395 aa AA seqDB search
MSLSRKVDQLKHFKFWRFVSSGPNTEYGLEKKWAYYDQDFVDREAAKPLHKLTPTQIMFH
GKFADGSHLVKSAHYLQQELPRRIARHIKDFQSLPYVVLINPIMQEVYELYLRAFRKLVH
VSEIDNLEKEREYSFLLSQLLNDHKDVVTYLAKAFRQVKKFVPYEVLGDLAERTLTSRLG
IRLLAEHHLALRHKKEYFIGIIGTQTSLKHIIERCVINCKDLCQHRFGYSPAVYVSGHTK
ATFPYIPAPVEYIMQELIKNSMRATVVRHIENPFEMPPIEVTICNNDEYFTIKISDKGGG
IPDSQLSDIFQYSFTTSTDDEGNLCETEDTFDNFSRAANDKGIGGVLSGYGFGLPSAAAY
AKFLGGSLTLVSMYGLGTDVFLKLIHINQPNCFRI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttagcagaaaggtcgatcagctaaaacacttcaaattttggagatttgtttca
agtggaccaaacactgaatatgggttagagaaaaaatgggcatactatgatcaagatttt
gttgatagagaggctgcaaagcctttacacaagttaactccaacacagattatgtttcat
ggaaaatttgctgatggatctcatcttgtgaaaagtgcccattatttgcaacaagaattg
cctcgccgaattgctcgacacataaaagattttcaaagcctgccgtatgttgttttgatt
aatccaattatgcaggaagtgtatgagttgtatcttcgggcttttcgtaagttggtacat
gtcagtgagattgacaacttagaaaaagagagagaatacagttttttattaagccagctt
ttaaatgatcacaaagatgttgttacttaccttgcaaaagcttttcgtcaagtgaaaaag
tttgtaccttatgaagtcttaggtgatttggctgaacgaactttaacatctcgattaggc
attcgtctgttagctgagcatcatcttgcattaagacataaaaaggaatatttcattggt
ataataggaacccaaacatctttaaagcacattattgaaagatgtgttattaactgcaaa
gatttatgtcaacatcgctttggatactcccctgctgtttatgtatctggccatacaaag
gcaacttttccatacatccctgctcctgtagaatatataatgcaagaactgataaaaaat
tcgatgagggcaacagttgtacgccacattgaaaatccttttgaaatgccaccaatagaa
gtaaccatttgtaataatgatgaatacttcacaatcaaaatatccgacaaaggaggtggt
attccagactctcaactttctgatatctttcaatattcgtttaccactagtacagatgac
gagggaaatctttgtgaaacggaagatacatttgataatttctcacgggcagctaacgat
aaaggtattggcggtgtactttctggatatggatttggtttaccttctgctgctgcatat
gctaaatttttaggaggatctctcacgctggtttcaatgtacggacttggaaccgatgta
tttttaaaattgattcatataaatcaaccaaattgttttcgaatataa

DBGET integrated database retrieval system