KEGG   Hydra vulgaris: 100215123Help
Entry
100215123         CDS       T01080                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 428 aa AA seqDB search
MTGLVYDPIMLKHQCTCGESYPKHPESAGRLQSIWARLQETGVANMCELIRPRKATIAEL
QTVHSEKHTLLYGSGTRKEGTQNLRCFTTLSCGGVGVDAVTVWNDTHTSNAARMAAGCVI
ELAFKVASNELKNGFAIVRPPGHHAETHQAMGYCYFNSVAIAAKLLCLKMAAERVLIFDW
DIHHGNGTQQMFYDDDRVLYISIHRHDEGSFFPGTGKAEECGAGIGVGCNINIPFDGGLG
IYKFCWFIKWFCCYCLNLCKNFQPDIILISAGFNAAGGHSDALGGYNVSSACFSYMTKEL
MQFANGKVVLVLEGGYILQTLCDASESCIRALLGCSTNELSEKVLKGKPNDNAIKCLEKV
VELQGRYWPGIKHVASNLNSHFYGIKTEKEDVDAVSALASLSMQVTQSTSVEKVPNLSNK
KEEPMDES
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgactggtttagtttacgatcctataatgttaaagcatcagtgtacatgtggtgaaagt
tatcctaaacatccagaatcagctgggcgcttgcaaagcatttgggcaagacttcaggaa
acaggtgttgctaacatgtgtgagcttatacgacctcgcaaagctactatagcagagctt
caaacagtccatagcgaaaagcatactcttttatatggcagtggtacaagaaaagaaggc
actcaaaatttacgttgttttactactctatcatgtggtggagtaggggttgatgcggtt
acagtttggaacgatacccatacttcaaacgcagctcgcatggctgcaggatgtgtcatt
gaattagcttttaaagttgcttccaatgaattaaaaaatgggtttgctattgttagacct
cctggtcatcatgctgaaactcatcaagccatgggatactgctattttaattccgtagca
atcgctgcaaagttgttatgtttaaaaatggctgctgagcgagttctaatctttgattgg
gacattcatcatggcaatggaactcagcagatgttttatgatgatgatagagtgttgtat
atatcaattcatcgtcatgatgaaggatcattttttccaggaactggaaaggctgaggag
tgtggtgctggaataggagttggttgtaacattaacattccatttgatggaggattaggt
atttataaattttgttggtttattaaatggttttgttgttattgtttgaatttatgtaaa
aattttcaacctgacatcattctcatatctgcaggttttaatgctgctggaggtcattca
gatgcactaggcggttataatgtgtcttcggcatgtttttcatacatgacaaaggaacta
atgcagtttgctaatggcaaagttgttcttgtactggaaggagggtatatattacaaact
ctttgcgatgcttcagaaagttgtatacgtgctttgttgggttgttctacaaatgaatta
tcagagaaggtattaaaagggaagcctaatgacaatgcaataaaatgtttagagaaagtt
gttgaattgcaaggtagatattggccaggcattaagcatgtagcatctaatctcaactca
catttttatggcatcaaaactgaaaaagaagatgttgatgctgtttctgcgttagcctct
ctttcaatgcaagtaacacaaagtacttcagttgaaaaagtcccgaatttatcaaataaa
aaagaggaaccaatggatgaaagttaa

DBGET integrated database retrieval system