KEGG   Hydra vulgaris: 100215123Help
Entry
100215123         CDS       T01080                                 

Definition
(RefSeq) histone deacetylase 5-like
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100215123
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100215123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1009 aa AA seqDB search
MAGSELTSSNGDKKTSEKINSFAEQLLLLRRQQDEQYRHLTLLYKAQQDSLRQQQEHELS
QHYKRQTSLHPTTKNVASYMSTSSKPYDYQHTENTSSQVERRIEEAKPQGNAISEDVRNK
IRERVFRNIKKRNSKPDPRLSGQCKEDFITWSYKPQAYIESYAPDNDGLFDLPPLRKAAS
EPNLKRTPLYPYPKSRGRNKLYSATGESRYLSALDDQKEKRDDTSPLYLNSTEGNVFYEG
SQKNNLLFQSPSLPNINIESTNTKLYFPIHMSTLEHPPTDSTSDLKAPLQPDHPKYLDML
KTQYATNHRYLQHIIQERNLEPKEIDNLHLRYLPKSDNTTLSDVQRVKQLLESQNKLYLH
LTEPLGINSSYFERSKNVSKSRIINDSSSLSSPFHSQYYDMKTSSPTLDQHSLDSHQHSN
AHIRLPFLSNQDSFSSLHNASQPTRMRLKEHLREKLDATSSKSMSLDAHFHRLEKDNQIQ
EETEEDVAKEEKVRSQVSSSLTDGSSLTNPSNGYSPGCLYGSNPQLSESYSGIYGSKLKF
RDFDSSLHGSDSRLYDSQLQTKKSETDDKLSLNLFKHPKEMTGLVYDPIMLKHQCTCGES
YPKHPESAGRLQSIWARLQETGVANMCELIRPRKATIAELQTVHSEKHTLLYGSGTRKEG
TQNLRCFTTLSCGGVGVDAVTVWNDTHTSNAARMAAGCVIELAFKVASNELKNGFAIVRP
PGHHAETHQAMGYCYFNSVAIAAKLLCLKMAAERVLIFDWDIHHGNGTQQMFYDDDRVLY
ISIHRHDEGSFFPGTGKAEECGAGIGVGCNINIPFDGGLDLEYGDKEYLAAFQTVVLPVV
KEYQPDIILISAGFNAAGGHSDALGGYNVSSACFSYMTKELMQFANGKVVLVLEGGYILQ
TLCDASESCIRALLGCSTNELSEKVLKGKPNDNAIKCLEKVVELQGRYWPGIKHVASNLN
SHFYGIKTEKEDVDAVSALASLSMQVTQSTSVEKVPNLSNKKEEPMDES
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggctggttctgaactgacatcatctaatggtgataaaaagacttctgaaaagatcaat
agttttgcagagcaattgttgctacttcgtcgtcagcaagatgagcagtaccgtcattta
acattgttatacaaagcacaacaagactccctacggcagcaacaagaacatgaattaagc
cagcattataagcgacaaacatcattacatccaacaacaaaaaatgttgcttcatatatg
tcaacatcctccaaaccttatgattaccaacatactgagaacacaagtagccaagtcgaa
agaagaatagaagaagctaaaccacaaggcaatgcaatttcagaagatgttcggaataaa
attcgtgaaagagtgtttaggaatataaaaaagagaaatagcaaacctgatcctcggctt
tctggacaatgcaaagaagattttattacatggtcatataaacctcaggcatacattgaa
tcatatgctccagacaatgatgggctctttgatctacctcctcttcgaaaagctgcttct
gaaccaaatttaaaacgaactccattatatccatatcccaagtctcgaggtcgaaataaa
ttatattctgctacaggagaaagcaggtatctttcagctttagatgatcaaaaagaaaaa
agagatgatacctctccattatatcttaactctacagaaggaaatgttttttatgaaggc
tcgcaaaagaataatttgttattccagtcaccttcattaccaaatatcaacatagaaagt
acaaatactaagctttattttccaatacatatgagcacccttgaacatcccccaaccgat
tctacgtctgatctaaaagcacccttacaaccagatcacccaaaatacttagatatgtta
aaaactcagtatgcaacaaatcatcgatacctacaacacattatacaggagagaaacctg
gaacctaaagaaatagacaatttacatcttcgttatctaccaaaatctgataatactact
ttatcagatgtacaacgagtaaagcaattacttgagtctcagaataaactctacttgcat
ttgactgagcctcttggcattaattcttcttactttgaaaggtctaaaaatgtttctaaa
tcacgaataattaatgactcttcctcacttagttccccatttcattcacagtattatgat
atgaaaacatctagtccaacattagatcaacatagcttagattcacatcaacacagtaat
gctcatataagattaccttttttatctaatcaagattcgttttcatctcttcataatgca
agccagccaacacgcatgcgtttaaaagaacatcttagagaaaaattagatgctacatct
tcaaaatctatgtctttggatgctcattttcatcgattagaaaaagataatcagattcag
gaagaaacagaggaggatgttgctaaagaagaaaaagttcggtcacaagtttcatcttca
ttaactgatggaagttcactgaccaatccttcaaatgggtatagtccaggttgcttatat
ggttcaaatccacagttatctgagtcatattcaggtatttatggatcaaaattaaaattt
cgtgactttgattctagtcttcatggatcagatagtcgtttgtatgattctcagttgcaa
actaaaaaatcagaaactgatgataaactttctttaaacttatttaagcatcctaaagaa
atgactggtttagtttacgatcctataatgttaaagcatcagtgtacatgtggtgaaagt
tatcctaaacatccagaatcagctgggcgcttgcaaagcatttgggcaagacttcaggaa
acaggtgttgctaacatgtgtgagcttatacgacctcgcaaagctactatagcagagctt
caaacagtccatagcgaaaagcatactcttttatatggcagtggtacaagaaaagaaggc
actcaaaatttacgttgttttactactctatcatgtggtggagtaggggttgatgcggtt
acagtttggaacgatacccatacttcaaacgcagctcgcatggctgcaggatgtgtcatt
gaattagcttttaaagttgcttccaatgaattaaaaaatgggtttgctattgttagacct
cctggtcatcatgctgaaactcatcaagccatgggatactgctattttaattccgtagca
atcgctgcaaagttgttatgtttaaaaatggctgctgagcgagttctaatctttgattgg
gacattcatcatggcaatggaactcagcagatgttttatgatgatgatagagtgttgtat
atatcaattcatcgtcatgatgaaggatcattttttccaggaactggaaaggctgaggag
tgtggtgctggaataggagttggttgtaacattaacattccatttgatggaggattagat
cttgagtatggtgataaggagtatttagctgcatttcaaacagtagttttacctgttgta
aaagaatatcaacctgacatcattctcatatctgcaggttttaatgctgctggaggtcat
tcagatgcactaggcggttataatgtgtcttcggcatgtttttcatacatgacaaaggaa
ctaatgcagtttgctaatggcaaagttgttcttgtactggaaggagggtatatattacaa
actctttgcgatgcttcagaaagttgtatacgtgctttgttgggttgttctacaaatgaa
ttatcagagaaggtattaaaagggaagcctaatgacaatgcaataaaatgtttagagaaa
gttgttgaattgcaaggtagatattggccaggcattaagcatgtagcatctaatctcaac
tcacatttttatggcatcaaaactgaaaaagaagatgttgatgctgtttctgcgttagcc
tctctttcaatgcaagtaacacaaagtacttcagttgaaaaagtcccgaatttatcaaat
aaaaaagaggaaccaatggatgaaagttaa

DBGET integrated database retrieval system