KEGG   Hydra vulgaris: 100215492Help
Entry
100215492         CDS       T01080                                 

Gene name
nup205
Definition
(RefSeq) nuclear pore complex protein Nup205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
hmg  Hydra vulgaris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100215492 (nup205)
Messenger RNA biogenesis [BR:hmg03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100215492 (nup205)
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100215492 (nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1981 aa AA seqDB search
MWSSKEILHICESAIVYKQSEIYAELDEVLTKYKPIFLTLLKDQEKDSCHREKVKKANKE
GIQIDGHVSVIKLQESMIQDAFLLSDGLQLNEFTCVELLLAGEQQASNFPGMSTNLVAAL
LYHDGRKSLLSALKLLLTARPGVTWTLELDDRIVELIDKFTSQIIENGLYFDGRKDTTFV
IDTNKGKNIRKTIKEEHVVLVQEPGSKYLRHVETASGYGYSIKTNGPTSGPNRWSGPIGR
EIKLCDTLPIVNYISVSVTLPKIDKKSLSSDQKYLLDICKAISIGYCPNALANRNPGKLN
HARSIKTNKVRKFSIPEINFEATDYIDLIDWIKCELSEPLVNTHILDKNLTEMLTNGNLP
DVQHFPCHTQGVERCIKLVTKASDQVYVFFIHSVTKLLAHLKVRCLIIKDIRNHGDENAR
IIQAHLYEGIEPPQGLRHDFKDFMLLVSALYSKDPLQLELCCEYWIPPEPLGGMFSPKPL
KKNLQAIDERKLMLNKFVQHAGDVLLQPLYIPYIDMLTSLSNNEEAASYCFRLLTSSRST
ERSSFCIVSWDHFFLSLKQYYLSLRQVIEASDHRVHLHRHQEISPDELAGLESIIKLIKI
VAEKNENVRIAFCENQTWLPVASLLGLVCCPIPANLKGLLLETLAAFSKTPEVAASIWQS
LEASQVLQTNTCTQKSGIAVEIQEIESRNETYPETRGFMKLLDQLTNITIPQTLGAGHRT
PGFDPYLVFLIDSVFLKFKTRAYKDLSEKWDICSEVLQLFVKILQDYDPLPEHFQDTQVL
IQGVSFGKASKPPGYQLLSSLLNYSPMLRMVFSVIDDILELLKTVSSSSSLKGVLESAVG
SCLLLLESVFEKQALFTDLVRQNGSSLLLSSLDDLLLSVNPRTGAPDYLLIIARFLTINN
LKTSVVLSAIRILKYACDGLRVQKEIVSILSKDELGARELLVGFSEQLEIDDPEVVDELK
DENANVQDLIRQEVIQLLISTIKQPSHNLAQFLLGFEIHIPVSKTNLQDAGVKGFPKTCF
HSIITILNRTTMSYTPKFKELLYHILYLMCSHQEMGLPTRRYLRTSLNFFVQHSSVLPFL
KNEIDVDQIKFIRLANQQSWLLKALAIEIKVIAASHARSSLQQLIAVLFNDSCSNDCTST
SASNYANYPDLTHNDTGQSFMGPSFKLNAESKSLILSLLSSLSFVQDYPPNISLNFFDYS
AVEQLFINCEETDEVTSLCNVKKLYKVLMTEINNSQITTGQRYELLNEVKLVIKHAVDRN
LVRESFIAKTNSFDAWRQVVEVIFAVCPDDILSLNDKQTILVTLLKELFLQLNNTEHLPE
LTSPITGTILSLMANLWLLFAQFERVSSKNYPFMSSISGLLPSIISAITSAKQARMRANL
YGAFLYYVQIGNMQNSIVAGAVEDIFSKQSKEGWETVAAKELVKYGDMFFEVVAKDTCQG
SCISRMMSMSVLDVVASLDWQRRYLSIMSSRGYLRALVDQLQEDDVDLLNILSLQPDSMK
PLYMFQSKMTLLAKIGLTDVGAQSLIQVGVLSRLSECQFLDYHIDKLTMMATSSLAYSNN
QDPFLPTLIERYSSIFIAVSQLLLAFLSSLGVRHRIATKQIQNLIINHEEAFLNILHHGC
ENISKKSCQLLSMVISIMSLLVLNENSDDSWEILGDEQRHWRMFMNRVQRLMFVMLRKFS
YTHFSKQVEMVLEVDREGAFSPINVNHVEVQNTLLQIRSRIFTFFKNIVACKGLSGPYSR
IIFSPSLTDTHLLETRFSSGKSVNYKQLPSLHLLLTELKGCPEQLKQCVEANNILKRKVN
SVSDMTNDEINEILSQEPDTDRLPFHQRKAVVYRILEKLLMLREEQASYLTYILEHVVYI
LWRHLDYFYIHCIPNDDFFLDDANFSKSNYSSHARKLTEGSFSSTVLSDSSKVDQTKDSI
NTDLKIKKEDLLELKCEASKLLNEQLWSKVLDFDQLQGRPQKHSFLSALVRRIQSLIQLN
M
NT seq 5946 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgtctaaagaaatacttcatatttgtgaatcagctatagtgtacaagcagtct
gagatatatgctgaacttgatgaagtacttaccaaatacaaaccaatttttttgacatta
ttaaaagaccaggaaaaagatagttgtcatagagaaaaagttaaaaaagcaaataaagag
gggattcaaatagatggccatgtttcagtaattaaacttcaagagtcaatgattcaagat
gcctttctcttaagtgatggtttacagttaaatgaatttacatgtgttgagcttcttctc
gctggagaacaacaagcgtcaaattttccaggtatgtccactaatttggttgcagcacta
ttataccatgatggaagaaaatctttattgtctgctcttaaacttttgcttacggctaga
cctggtgttacatggacattagagttagatgacagaattgttgagctaattgacaagttt
acatcacagattattgaaaatggtttatattttgatggaagaaaagatacaacatttgtt
attgatacaaacaagggaaaaaatatacgaaaaactatcaaagaagaacatgtagtttta
gtacaagaaccagggtcaaagtatctaaggcatgtagagactgcatcaggatatggatac
agcattaagacaaatggacctacatcaggacctaacaggtggtctggaccaatcggaaga
gaaattaaattgtgtgataccttgccaattgtcaactacatttctgtcagtgtaacattg
ccaaaaatagacaaaaaatctcttagttctgatcaaaaatacttacttgatatttgcaaa
gctatatctataggttattgtccaaacgctttggctaaccgaaatcctggaaaacttaac
catgccagatcaatcaaaacaaacaaagttcgaaagttctctataccagaaatcaatttt
gaagcaacagactatatagaccttattgattggattaaatgtgaactaagtgaacctttg
gttaacactcacattttagataaaaatctaactgaaatgttaacaaatggtaatcttcca
gatgtgcagcattttccatgccatactcaaggagtagagagatgcatcaaacttgtaacc
aaagcttcagatcaagtttacgtattttttattcattctgtaactaaactactggctcac
ctaaaagttcgttgtttaattattaaagatattcgtaatcacggtgatgagaatgcacgt
attatacaagctcatctttatgaaggcattgaacctccccaaggattgagacatgatttt
aaagactttatgcttttggtgagtgcattatattcaaaagatccattgcagttagaactt
tgttgtgaatattggataccgccagaacctcttggaggaatgttttcacctaaaccgctt
aagaaaaatttgcaagctattgatgaaagaaagttgatgcttaacaagtttgttcaacat
gctggtgatgttttgctacagcctctatatataccatatattgatatgctaacatctttg
tcaaataacgaagaggctgcttcatattgctttcgtcttttgacttcaagcagatcaact
gaaagaagcagtttttgcatcgtttcctgggatcactttttcttatcactgaaacaatat
tacttgagtttaagacaagttattgaagcatctgaccaccgggttcatttgcatagacat
caagagatatcaccagatgagcttgctgggcttgaaagcattataaaattgataaaaatt
gtggcagagaagaatgaaaatgtcagaattgcattttgtgaaaatcaaacgtggctacct
gttgcatccttgttgggattggtttgttgtccaataccagctaatttaaaaggattgctt
ctggaaactttggcagctttttctaaaactcctgaagttgcagcttctatatggcagtca
ttagaagcatctcaggtccttcaaactaatacatgcacacaaaaatcaggaatagctgtc
gaaattcaagaaattgaaagtcgaaatgaaacttatcctgaaactcgtggtttcatgaag
ttgcttgatcaattaactaatataactattcctcaaactttaggagctggtcatcgaaca
cctggatttgacccatatcttgtttttttgattgatagtgtatttctcaaattcaaaaca
agggcatataaagacttaagtgaaaagtgggatatttgttcggaagtcttacaactgttt
gtgaaaattcttcaagactatgaccctctacctgaacattttcaagatactcaagtactg
attcaaggagtaagttttggtaaagcatcgaagcctcctggttaccaacttctaagttcg
ttgttaaattattctccaatgttacgaatggttttttctgtgatcgatgatatattggaa
cttttaaaaactgtttcctcttctagtagcttaaaaggtgtccttgaaagtgctgttggt
tcttgcttacttttgttggaatcagtttttgaaaagcaagctctgtttacagatttagta
agacaaaatggttcatcactgttactatcatctcttgatgacttattgctttctgtcaat
ccacgaactggtgcgcctgattatttactgatcatcgctagatttttaacaataaataac
ttaaagacaagtgttgtgttgagtgcaataagaatcctcaaatatgcttgtgacgggtta
agagttcaaaaagaaattgtatcaattctttctaaagatgagttaggtgccagagagctt
ttagttgggttttctgaacaattagagattgatgacccagaagttgttgatgaattgaag
gatgaaaatgctaatgttcaagacttgattcgacaagaggttatacagctgcttatatcg
accatcaaacagccatcccataacttggcacagtttttattaggttttgaaattcatatt
cctgtttcaaaaacaaatttacaagatgcaggtgtgaaaggctttccaaaaacatgtttt
cattcaatcatcactattttgaatagaactacgatgtcttatacaccaaaatttaaagaa
ttattgtaccacattttgtatctcatgtgttcgcatcaagaaatgggtttgccaacaagg
agatatctcagaacaagcttaaatttttttgttcagcattcttctgttttaccctttttg
aaaaatgaaattgatgttgatcaaattaagtttattcgattggctaaccaacaatcatgg
ttactaaaagcacttgcaattgaaattaaagttattgctgccagccatgccagatcaagt
ttgcagcaattaattgctgttttgtttaatgactcttgctcaaatgattgcacttcaact
tctgccagcaactacgctaattatcctgatctaactcataatgatactggacaatcattt
atgggaccatcttttaaactaaatgcagagtcaaaaagtttgatactatctcttttatct
tcactgtcatttgtacaggactatcctcctaacatcagtttaaatttttttgactattct
gctgttgagcagttatttataaactgtgaagaaactgatgaagttacatctctgtgtaat
gtaaagaagctttataaggtgctcatgaccgaaatcaataactcacaaattacaacagga
caacgctatgagttattaaacgaagtaaaattggttataaagcatgcagttgatcgcaat
cttgtgcgagaatcttttattgctaaaactaatagttttgatgcttggcgtcaagtagtt
gaagtaatatttgcagtttgccctgacgatattttatctcttaatgataagcagactatt
cttgtgactcttctaaaggaattatttttacagttaaacaatactgagcacttaccagaa
cttacatctcccataactggaactattttgagtttaatggctaatttatggttgttgttt
gctcagtttgaaagggtttcttcaaaaaattatccttttatgtcatccatctctggcttg
cttccatctattatttcagcaataacttctgctaaacaagctcgcatgagagctaatcta
tatggagcattcttgtattatgtgcaaattggaaatatgcaaaattctattgttgcaggt
gctgtagaagatattttttctaagcaatcaaaagaaggatgggaaacagtggcagcaaag
gaactagttaaatatggtgacatgttttttgaagtagttgcaaaagatacatgtcaagga
tcttgtatatcaaggatgatgtcaatgagtgtccttgacgtggttgcttctctagattgg
caacgcaggtatttatcgattatgtcatctcgtgggtatttacgtgctttagttgaccag
cttcaggaggatgatgtggatttacttaatatactctcattgcagcctgatagcatgaaa
ccattatatatgtttcaatccaaaatgacattgctggccaaaattggattgacggatgtg
ggtgctcagtcattgattcaggttggagtattatctcgtttgagtgagtgtcaattttta
gattaccatattgataaacttacaatgatggctacctcgtctctggcttacagtaacaac
caggatccatttttacctactttaatagaacgttattcatcaatattcatagctgtttct
caattgttacttgcttttttatcgtctcttggtgtgcgtcatcgaattgctacaaaacaa
attcaaaatttaattataaatcatgaagaagctttccttaatattctccatcacggttgt
gaaaatatttctaaaaaatcttgccagcttttgtctatggttatctccattatgtcgctg
ttagttttaaatgaaaattcagatgacagttgggagatcttgggcgatgaacaaagacac
tggcgtatgtttatgaatcgtgtgcaaagacttatgtttgtaatgcttcgaaagttttct
tatactcatttttccaaacaagtggaaatggttttagaagttgatcgtgaaggtgcattt
tcacccatcaatgttaatcacgttgaagtacaaaacacattgttacaaatacgttcaaga
atattcactttttttaaaaatattgttgcttgtaaaggtttgagtggcccttactcgaga
attatattttcgccatctttaactgatactcatttactcgaaaccagatttagtagcgga
aagtctgttaactacaagcaattgccatcattgcaccttttgttgactgagttaaaaggt
tgcccagagcaattaaaacaatgtgtagaggctaataacattttaaaaagaaaagtaaat
tctgtgtctgacatgacaaatgacgaaattaatgagattttgtctcaagaacctgacact
gatcgcttacctttccatcaacgaaaggctgtggtttaccgtattctagaaaaacttctt
atgcttcgagaagaacaagctagttatttgacttatattctagagcacgtggtttacatc
ctttggaggcatctagactacttttatattcactgtatcccgaatgacgattttttcctt
gatgatgcaaacttttcaaagagtaattattcttcgcacgctcgcaaactcactgaggga
agcttttcttcgactgttctttctgattcatctaaagttgatcaaacaaaagattcaata
aacactgacttaaaaataaaaaaagaggatttgctggagttaaagtgcgaagcttctaag
ttactcaacgaacagttatggagcaaagtacttgatttcgatcagttacaaggacgccct
caaaaacattcttttttgtcagcactggtgcgtcgaattcaaagtcttattcaattaaac
atgtga

DBGET integrated database retrieval system