KEGG   Hydra vulgaris: 100215492Help
Entry
100215492         CDS       T01080                                 

Gene name
nup205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
hmg  Hydra vulgaris
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:hmg03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2069 aa AA seqDB search
MWSSKEILHICESAIVYKQSEIYAELDEVLTKYKPIFLTLLKDQEKDSCHREKVKKANKE
GIQIDGHVSVIKLQESMIQDAFLLSDGLQLNEFTCVELLLAGEQQASNFPGMSTNLVAAL
LYHDGRKSLLSALKLLLTARPGVTWTLELDDRIVELIDKFTSQIIENGLYFDGRKDTTFV
IDTNKGKNIRKTIKEEHVVLVQEPGSKYLRHVETASGYGYSIKTKLKRPVHWFVCQIHAN
ELPLWHLIQNIDGPTSGPNRWSGPIGREIKLCDTLPIVNYISVSVTLPKIDKKSLSSDQK
YLLDICKAISIGYCPNALANRNPGKLNHARWVTTANRILRYYVGCSEPSHKLREIVEFVI
RVYCQMWFNIRYDPSCTEDLIDWIKCELSEPLVNTHILDKNLTEMLTNGNLPDVQHFPCH
TQGVERCIKLVTKASDQVYGLASRDGFIRARLASQKKMPIFNTKRQFETETNESDIFFIH
SVTKLLAHLKVRCLIIKDIRNHGDENARIIQAHLYEGIEPPQGLRHDFKDFMLLVSALYS
KDPLQLELCCEYWIPPEPLGGMFSPKPLKKNLQAIDERKLMLNKFVQHAGDVLLQPLYIP
YIDMLTSLSNNEEAASYCFRLLTSSRSTERSSFCIVSWDHFFLSLKQYYLSLRQVIEASD
HRVHLHRHQEISPDELAGLESIIKLIKIVAEKNENVRIAFCENQTWLPVASLLGLVCCPI
PANLKGLLLETLAAFSKTPEVAASIWQSLEASQVLQTNTCTQKSGIAVEIQEIESRNETY
PETRGFMKLLDQLTNITIPQTLGAGHRTPGFDPYLVFLIDSVFLKFKTRAYKDLSEKWDI
CSEVLQLFVKILQDYDPLPEHFQDTQVLIQGVSFGKASKPPGYQLLSSLLNYSPMLRMVF
SVIDDILELLKTVSSSSSLKGVLESAVGSCLLLLESVFEKQALFTDLVRQNGSSLLLSSL
DDLLLSVNPRTGAPDYLLIIARFLTINNLKTSVVLSAIRILKYACDGLRVQKEIVSILSK
DELGARELLVGFSEQLEIDDPEVVDELKDENANVQDLIRQEVIQLLISTIKQPSHNLAQF
LLGFEIHIPVSKTNLQDAGVKGFPKTCFHSIITILNRTTMSYTPKFKELLYHILYLMCSH
QEMGLPTRRYLRTSLNFFVQHSSVLPFLKNEIDVDQIKFIRLANQQSWLLKALAIEIKVI
AASHARSSLQQLIAVLFNDSCSNDCTSTSASNYANYPDLTHNDTGQSFMGPSFKLNAESK
SLILSLLSSLSFVQDYPPNISLNFFDYSAVEQLFINCEETDEVTSLCNVKKLYKVLMTEI
NNSQITTGQRYELLNEVKLVIKHAVDRNLVRESFIAKTNSFDAWRQVVEVIFAVCPDDIL
SLNDKQTILVTLLKELFLQLNNTEHLPELTSPITGTILSLMANLWLLFAQFERVSSKNYP
FMSSISGLLPSIISAITSAKQARMRANLYGAFLYYVQIGNMQNSIVAGAVEDIFSKQSKE
GWETVAAKELVKYGDMFFEVVAKDTCQGSCISRMMSMSVLDVVASLDWQRRYLSIMSSRG
YLRALVDQLQEDDVDLLNILSLQPDSMKPLYMFQSKMTLLAKIGLTDVGAQSLIQVGVLS
RLSECQFLDYHIDKLTMMATSSLAYSNNQDPFLPTLIERYSSIFIAVSQLLLAFLSSLGV
RHRIATKQIQNLIINHEEAFLNILHHGCENISKKSCQLLSMVISIMSLLVLNENSDDSWE
ILGDEQRHWRMFMNRVQRLMFVMLRKFSYTHFSKQVEMVLEVDREGAFSPINVNHVEVQN
TLLQIRSRIFTFFKNIVACKGLSGPYSRIIFSPSLTDTHLLETRFSSGKSVNYKQLPSLH
LLLTELKGCPEQLKQCVEANNILKRKVNSVSDMTNDEINEILSQEPDTDRLPFHQRKAVV
YRILEKLLMLREEQASYLTYILEHVVYILWRHLDYFYIHCIPNDDFFLDDANFSKSNYSS
HARKLTEGSFSSTVLSDSSKVDQTKDSINTDLKIKKEDLLELKCEASKLLNEQLWSKVLD
FDQLQGRPQKHSFLSALVRRIQSLIQLNM
NT seq 6210 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgtctaaagaaatacttcatatttgtgaatcagctatagtgtacaagcagtct
gagatatatgctgaacttgatgaagtacttaccaaatacaaaccaatttttttgacatta
ttaaaagaccaggaaaaagatagttgtcatagagaaaaagttaaaaaagcaaataaagag
gggattcaaatagatggccatgtttcagtaattaaacttcaagagtcaatgattcaagat
gcctttctcttaagtgatggtttacagttaaatgaatttacatgtgttgagcttcttctc
gctggagaacaacaagcgtcaaattttccaggtatgtccactaatttggttgcagcacta
ttataccatgatggaagaaaatctttattgtctgctcttaaacttttgcttacggctaga
cctggtgttacatggacattagagttagatgacagaattgttgagctaattgacaagttt
acatcacagattattgaaaatggtttatattttgatggaagaaaagatacaacatttgtt
attgatacaaacaagggaaaaaatatacgaaaaactatcaaagaagaacatgtagtttta
gtacaagaaccagggtcaaagtatctaaggcatgtagagactgcatcaggatatggatac
agcattaagacaaaactcaaaagacctgtccactggtttgtttgtcaaatacatgctaat
gaactgcctctatggcatctaattcaaaacatagatggacctacatcaggacctaacagg
tggtctggaccaatcggaagagaaattaaattgtgtgataccttgccaattgtcaactac
atttctgtcagtgtaacattgccaaaaatagacaaaaaatctcttagttctgatcaaaaa
tacttacttgatatttgcaaagctatatctataggttattgtccaaacgctttggctaac
cgaaatcctggaaaacttaaccatgccaggtgggtgaccactgcaaacagaatattgagg
tattatgttggatgtagcgaaccgtcgcacaagctgagagaaatagttgagtttgttatt
agagtttactgccaaatgtggttcaatataagatatgatccctcatgcacggaagacctt
attgattggattaaatgtgaactaagtgaacctttggttaacactcacattttagataaa
aatctaactgaaatgttaacaaatggtaatcttccagatgtgcagcattttccatgccat
actcaaggagtagagagatgcatcaaacttgtaaccaaagcttcagatcaagtttacggt
ttggctagtagagacggcttcattcgtgcaagacttgcatcgcaaaaaaaaatgcctata
ttcaacacaaaaagacagtttgagacagagacaaatgaatcagatatattttttattcat
tctgtaactaaactactggctcacctaaaagttcgttgtttaattattaaagatattcgt
aatcacggtgatgagaatgcacgtattatacaagctcatctttatgaaggcattgaacct
ccccaaggattgagacatgattttaaagactttatgcttttggtgagtgcattatattca
aaagatccattgcagttagaactttgttgtgaatattggataccgccagaacctcttgga
ggaatgttttcacctaaaccgcttaagaaaaatttgcaagctattgatgaaagaaagttg
atgcttaacaagtttgttcaacatgctggtgatgttttgctacagcctctatatatacca
tatattgatatgctaacatctttgtcaaataacgaagaggctgcttcatattgctttcgt
cttttgacttcaagcagatcaactgaaagaagcagtttttgcatcgtttcctgggatcac
tttttcttatcactgaaacaatattacttgagtttaagacaagttattgaagcatctgac
caccgggttcatttgcatagacatcaagagatatcaccagatgagcttgctgggcttgaa
agcattataaaattgataaaaattgtggcagagaagaatgaaaatgtcagaattgcattt
tgtgaaaatcaaacgtggctacctgttgcatccttgttgggattggtttgttgtccaata
ccagctaatttaaaaggattgcttctggaaactttggcagctttttctaaaactcctgaa
gttgcagcttctatatggcagtcattagaagcatctcaggtccttcaaactaatacatgc
acacaaaaatcaggaatagctgtcgaaattcaagaaattgaaagtcgaaatgaaacttat
cctgaaactcgtggtttcatgaagttgcttgatcaattaactaatataactattcctcaa
actttaggagctggtcatcgaacacctggatttgacccatatcttgtttttttgattgat
agtgtatttctcaaattcaaaacaagggcatataaagacttaagtgaaaagtgggatatt
tgttcggaagtcttacaactgtttgtgaaaattcttcaagactatgaccctctacctgaa
cattttcaagatactcaagtactgattcaaggagtaagttttggtaaagcatcgaagcct
cctggttaccaacttctaagttcgttgttaaattattctccaatgttacgaatggttttt
tctgtgatcgatgatatattggaacttttaaaaactgtttcctcttctagtagcttaaaa
ggtgtccttgaaagtgctgttggttcttgcttacttttgttggaatcagtttttgaaaag
caagctctgtttacagatttagtaagacaaaatggttcatcactgttactatcatctctt
gatgacttattgctttctgtcaatccacgaactggtgcgcctgattatttactgatcatc
gctagatttttaacaataaataacttaaagacaagtgttgtgttgagtgcaataagaatc
ctcaaatatgcttgtgacgggttaagagttcaaaaagaaattgtatcaattctttctaaa
gatgagttaggtgccagagagcttttagttgggttttctgaacaattagagattgatgac
ccagaagttgttgatgaattgaaggatgaaaatgctaatgttcaagacttgattcgacaa
gaggttatacagctgcttatatcgaccatcaaacagccatcccataacttggcacagttt
ttattaggttttgaaattcatattcctgtttcaaaaacaaatttacaagatgcaggtgtg
aaaggctttccaaaaacatgttttcattcaatcatcactattttgaatagaactacgatg
tcttatacaccaaaatttaaagaattattgtaccacattttgtatctcatgtgttcgcat
caagaaatgggtttgccaacaaggagatatctcagaacaagcttaaatttttttgttcag
cattcttctgttttaccctttttgaaaaatgaaattgatgttgatcaaattaagtttatt
cgattggctaaccaacaatcatggttactaaaagcacttgcaattgaaattaaagttatt
gctgccagccatgccagatcaagtttgcagcaattaattgctgttttgtttaatgactct
tgctcaaatgattgcacttcaacttctgccagcaactacgctaattatcctgatctaact
cataatgatactggacaatcatttatgggaccatcttttaaactaaatgcagagtcaaaa
agtttgatactatctcttttatcttcactgtcatttgtacaggactatcctcctaacatc
agtttaaatttttttgactattctgctgttgagcagttatttataaactgtgaagaaact
gatgaagttacatctctgtgtaatgtaaagaagctttataaggtgctcatgaccgaaatc
aataactcacaaattacaacaggacaacgctatgagttattaaacgaagtaaaattggtt
ataaagcatgcagttgatcgcaatcttgtgcgagaatcttttattgctaaaactaatagt
tttgatgcttggcgtcaagtagttgaagtaatatttgcagtttgccctgacgatatttta
tctcttaatgataagcagactattcttgtgactcttctaaaggaattatttttacagtta
aacaatactgagcacttaccagaacttacatctcccataactggaactattttgagttta
atggctaatttatggttgttgtttgctcagtttgaaagggtttcttcaaaaaattatcct
tttatgtcatccatctctggcttgcttccatctattatttcagcaataacttctgctaaa
caagctcgcatgagagctaatctatatggagcattcttgtattatgtgcaaattggaaat
atgcaaaattctattgttgcaggtgctgtagaagatattttttctaagcaatcaaaagaa
ggatgggaaacagtggcagcaaaggaactagttaaatatggtgacatgttttttgaagta
gttgcaaaagatacatgtcaaggatcttgtatatcaaggatgatgtcaatgagtgtcctt
gacgtggttgcttctctagattggcaacgcaggtatttatcgattatgtcatctcgtggg
tatttacgtgctttagttgaccagcttcaggaggatgatgtggatttacttaatatactc
tcattgcagcctgatagcatgaaaccattatatatgtttcaatccaaaatgacattgctg
gccaaaattggattgacggatgtgggtgctcagtcattgattcaggttggagtattatct
cgtttgagtgagtgtcaatttttagattaccatattgataaacttacaatgatggctacc
tcgtctctggcttacagtaacaaccaggatccatttttacctactttaatagaacgttat
tcatcaatattcatagctgtttctcaattgttacttgcttttttatcgtctcttggtgtg
cgtcatcgaattgctacaaaacaaattcaaaatttaattataaatcatgaagaagctttc
cttaatattctccatcacggttgtgaaaatatttctaaaaaatcttgccagcttttgtct
atggttatctccattatgtcgctgttagttttaaatgaaaattcagatgacagttgggag
atcttgggcgatgaacaaagacactggcgtatgtttatgaatcgtgtgcaaagacttatg
tttgtaatgcttcgaaagttttcttatactcatttttccaaacaagtggaaatggtttta
gaagttgatcgtgaaggtgcattttcacccatcaatgttaatcacgttgaagtacaaaac
acattgttacaaatacgttcaagaatattcactttttttaaaaatattgttgcttgtaaa
ggtttgagtggcccttactcgagaattatattttcgccatctttaactgatactcattta
ctcgaaaccagatttagtagcggaaagtctgttaactacaagcaattgccatcattgcac
cttttgttgactgagttaaaaggttgcccagagcaattaaaacaatgtgtagaggctaat
aacattttaaaaagaaaagtaaattctgtgtctgacatgacaaatgacgaaattaatgag
attttgtctcaagaacctgacactgatcgcttacctttccatcaacgaaaggctgtggtt
taccgtattctagaaaaacttcttatgcttcgagaagaacaagctagttatttgacttat
attctagagcacgtggtttacatcctttggaggcatctagactacttttatattcactgt
atcccgaatgacgattttttccttgatgatgcaaacttttcaaagagtaattattcttcg
cacgctcgcaaactcactgagggaagcttttcttcgactgttctttctgattcatctaaa
gttgatcaaacaaaagattcaataaacactgacttaaaaataaaaaaagaggatttgctg
gagttaaagtgcgaagcttctaagttactcaacgaacagttatggagcaaagtacttgat
ttcgatcagttacaaggacgccctcaaaaacattcttttttgtcagcactggtgcgtcga
attcaaagtcttattcaattaaacatgtga

DBGET integrated database retrieval system