KEGG   Hydra vulgaris: 100215590Help
Entry
100215590         CDS       T01080                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP-like
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
hmg  Hydra vulgaris
Pathway
Ubiquitin mediated proteolysis
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100215590
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    100215590
Enzymes [BR:hmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100215590
Ubiquitin system [BR:hmg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100215590
Mitochondrial biogenesis [BR:hmg03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100215590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 426 aa AA seqDB search
MEKLTSDLSPIDYSIYLHRLNTYAINMWPKSAPEFVKYLAEAGFVFTGKNDLVYCFECKI
ELSGWLEDHNPIQRHKDVNSNCPFIIQQSKKKLVNDDKNDDKLYNPNMKSEDKRYQSFGM
CPPEKHWPSPEKLAKSGMYYDYSKKMMVCFCCGFMVDSWESAEQDPYVKHKSAESSCSFI
KRVQNKDNFVEEKTTISNPNLIERFPSYKTEWTKPAILIDYSNEHTRLQTFFSYPRNSPV
SADSLVKAGFYYLGRNDEVMCYKCSVSLKDFEIGDTAWGEHRRHSPACPLVKNYLNSNNS
KNTYSGTSSFSNRVVGSVKECNESPIQNANFLRNLSADSSLSNFSSFESENLLNTGRKAY
SESDLKSIQNLSHSIDLSCVICMDNNKEMIFLPCAHLIACSSCAKGQAFCPMCRSPIVST
LKTYMS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttaacgtcggatttatcgccaattgattactccatatatcttcatcgttta
aatacatatgcaataaatatgtggcctaaatcagccccagagtttgtaaaatatttagct
gaagcaggattcgttttcacaggaaaaaatgatttagtgtattgttttgaatgcaaaata
gaactttctggttggttagaggaccataatccaattcaacgtcataaggatgttaattca
aattgtccttttataattcagcaatccaaaaaaaaactggttaatgatgataaaaatgat
gataagctttacaatccaaatatgaaatctgaggataaacgctatcagtcttttggaatg
tgtccacctgaaaaacactggccatcaccagaaaaattagccaaatcaggaatgtactat
gattatagcaaaaaaatgatggtctgtttttgttgtggtttcatggtggattcatgggaa
agtgctgagcaagatccttatgtgaaacataaaagtgctgagtcaagttgctcatttata
aaacgtgtacaaaataaggataactttgttgaagaaaaaacgacaatttcaaatcctaat
ttaatagaaagatttccttcttataaaactgaatggactaaaccagcaatactaattgac
tactccaatgagcatactcggctgcaaacattttttagttatcctagaaactctccagta
tccgctgattctttagttaaggctggattttattacttgggtaggaatgatgaagtaatg
tgttataagtgttcagttagtttaaaagactttgaaattggtgacactgcctggggtgaa
cataggcggcattcaccagcttgcccacttgttaaaaattatttaaactcaaataattca
aaaaatacatattctggaacaagttctttttcaaaccgagtggttggttccgttaaggag
tgcaatgaaagtcctattcaaaatgcaaattttttaagaaatctttctgcagactcatca
ctatccaatttttcatcattcgaaagtgaaaatctgttaaacacagggcgtaaagcttat
tcagaaagcgatttaaaatcaatacagaatttatctcattctatagatttatcttgtgta
atatgtatggacaataataaagaaatgatatttttaccgtgtgcacacctaattgcatgt
agttcatgtgcaaaaggtcaagctttttgtccaatgtgcaggtctcctattgttagtaca
ttaaaaacatatatgagttga

DBGET integrated database retrieval system