KEGG   Hydra vulgaris: 100215590Help
Entry
100215590         CDS       T01080                                 

Definition
baculoviral IAP repeat-containing protein 2-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
hmg  Hydra vulgaris
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100215590
Mitochondrial biogenesis [BR:hmg03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100215590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 323 aa AA seqDB search
MEKLTSDLSPIDYSIYLHRLNTYAINMWPKSAPEFVKYLAEAGFVFTGKNDLVYCFECKI
ELSGWLEDHNPIQRHKDVNSNCPFIIQQSKKKLVNDDKNDDKLYNPNMKSEDKRYQSFGM
CPPEKHWPSPEKLAKSGMYYDYSKKMMVCFCCGFMVDSWESAEQDPYVKHKRAESSCSFI
KRVPCPLVKNYLNSNNSKNTYSGTSSFSNRVVGSVKECNESPIQNANFLRNLSADSSLSN
FSSFESENLLNTGRKAYSESDLKSIQNLSHSIDLSCVICMDNNKEMIFLPCAHLIACSSC
AKGQAFCPMCRSPIVSTLKTYMS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttaacgtcggatttatcgccaattgattactccatatatcttcatcgttta
aatacatatgcaataaatatgtggcctaaatcagccccagagtttgtaaaatatttagct
gaagcaggattcgttttcacaggaaaaaatgatttagtgtattgttttgaatgcaaaata
gaactttctggttggttagaggaccataatccaattcaacgtcataaggatgttaattca
aattgtccttttataattcagcaatccaaaaaaaaactggttaatgatgataaaaatgat
gataagctttacaatccaaatatgaaatctgaggataaacgctatcagtcttttggaatg
tgtccacctgaaaaacactggccatcaccagaaaaattagccaaatcaggaatgtactat
gattatagcaaaaaaatgatggtctgtttttgttgtggtttcatggtggattcatgggaa
agtgctgagcaagatccttatgtgaaacataagcgtgctgagtcaagttgctcatttata
aaacgtgtaccttgcccacttgttaaaaattatttaaactcaaataattcaaaaaataca
tattctggaacaagttctttttcaaaccgagtggttggttccgttaaggagtgcaatgaa
agtcctattcaaaatgcaaattttttaagaaatctttctgcagactcatcactatccaat
ttttcatcattcgaaagtgaaaatctgttaaacacagggcgtaaagcttattcagaaagc
gatttaaaatcaatacagaatttatctcattctatagatttatcttgtgtaatatgtatg
gacaataataaagaaatgatatttttaccgtgtgcacacctaattgcatgtagttcatgt
gcaaaaggtcaagctttttgtccaatgtgcaggtctcctattgttagtacattaaaaaca
tatatgagttga

DBGET integrated database retrieval system