KEGG   Hydra vulgaris: 100215739Help
Entry
100215739         CDS       T01080                                 

Definition
uncharacterized LOC100215739
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hmg  Hydra vulgaris
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hmg00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 925 aa AA seqDB search
MAHVMPRVYKRKSKTPHVSENILKVAVAEVENGMSLREAACSAGIFKSALHRCIKKKCQY
PAANLQPNYQHSMIFSVAQEETLSTYLKTCSDMLYGLTPVQVRALAFEMAQANKIKCPMR
WIEQKKAGRDWLTGFLKINPKLSVRKPEATSMARASAFNRYTIDIFFNKLQEGISESKAT
SFKIFNLDETGFTTVQKTPRVIASKGTKQVRQITSRERGELVTVCCIVSAAGVAIPHVIV
FPRKLFRNPLMRGASEGSIGLANQSGWMNAEVFIDVLKHFVKFACPIADHKVLLIMNNLE
SHLSLQSLEYAKENHVCMMTLPPYTSHKTQPLNRSVFGPMKTYFNAAVNSWMLSNPGKAI
TIYEMDSLIRQAWEKSSTPTNIMSGFRVTGIWPYDRHVYGDNIFLPSNVTDRNVPQESYS
EDSCEKSITTATPSDISGLDAQHEAVKENLTVFSPEIVRGYPKAPSRKILRRGRKKGKCM
IATSTPEILRIKDEHYHGGNFIGNDCRKLLKNVDLLQQVAEEKAAVHVFPLIDALRKFDA
VVIACIGNEMQQDYAQKIELFKQSFLALSAGSVTPKVHAVFFHIKDFISSKNTSLGIDSE
QTTEAVHHQFQTLWQRYKRQKTHPEYESQLQKIESEVKWPSPGSFFSINLKMLDHSPSLC
SSSNSNLSETVKDILPNTLISPCEPVSNLTHTNKEKHLQTKDDLKETRKRLIYSPLKGTP
PKRLRVENEDVDLESSFRFDNTMKNYLRPFDCSTPNQPKKKPSSPTSLPTSSTFDHHNNN
TDIDFKRVDVVNGAVFNEDHDELVIVKDIDFFSMCEHHLVTFYGKVHVGYLPNKKVIGIS
KIARIVEIFSRRLQVQERLTKQIALALFEAVSPSGVGVVIEACHMCMVMRGVQKVGASTV
TSCMLGAFRDDPKSRNEFLTLIRNK
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgtcatgcctagagtttataaaaggaaaagtaaaactccacatgtttcagaa
aacattttgaaggttgctgtagctgaagtggaaaatgggatgagccttagagaagcagca
tgttcagctggcatttttaagtctgcacttcataggtgtattaaaaaaaagtgtcaatac
ccagctgctaatcttcaaccaaattatcaacattctatgattttctctgttgcacaagaa
gaaacactaagcacttatctaaagacatgttctgatatgttatatggtcttacaccagtt
caagtaagagctctagcttttgaaatggctcaagcaaacaaaataaaatgtcccatgcgt
tggatagagcaaaaaaaggctggtcgagattggttaacaggatttttaaaaataaaccca
aaactatcagttagaaaaccagaggcaacttcaatggcaagagcatcagcatttaatcgg
tatactattgatattttctttaacaaattacaagaaggtatatcagagtctaaagcaaca
tcgtttaaaatttttaatcttgatgagacaggttttactactgtacaaaaaactcctcgt
gtcattgcatcaaagggaacaaagcaagtcaggcaaataacatctagagaaagaggtgaa
ttagtaacagtgtgttgcattgtctctgcagctggtgtagcaataccccatgttattgtt
tttccaagaaaattatttagaaacccactaatgagaggagcatcagaaggttctattgga
ttagccaatcaatctggatggatgaatgctgaagtatttattgatgttttaaagcatttt
gttaagtttgcttgtccaatagccgatcacaaagttttattgattatgaataatcttgaa
agccacctttcactacagtcacttgaatatgcaaaagagaaccatgtttgtatgatgact
ttgccaccatatacttcacataagacacaacctttaaataggtctgtttttggcccaatg
aaaacatattttaatgcagctgtcaatagctggatgcttagcaatccaggaaaagccatt
acaatttatgagatggacagtctcattcgacaagcatgggaaaaatcttccacaccaaca
aatattatgtcaggatttcgcgtgaccggaatttggccttatgatagacatgtatatggg
gataatatttttttaccatcaaatgtaacagatagaaatgtgcctcaagaatcatacagt
gaagactcatgtgagaaatcgattacaactgctactccttcagatatctcaggtttggat
gcgcaacatgaagcagtaaaagaaaacttaactgtattttctcctgagattgtacgaggt
tatccaaaggcaccttctcgtaagattttaagacgtggacgtaaaaagggaaagtgtatg
atagccacatcaacaccagagattttaagaataaaagatgaacattaccatggaggtaat
ttcattggcaatgattgccgcaagcttctcaaaaatgttgatcttcttcaacaggtggcc
gaagagaaggcagcagttcatgtttttccacttattgatgctctgagaaagtttgatgct
gtggttattgcctgcattggaaatgaaatgcagcaagactatgcacaaaaaattgaactt
ttcaagcaatcgttcttggcactatcagcaggaagtgtaactccaaaagttcatgctgtg
ttttttcacatcaaggatttcatctcaagtaaaaacacttctttgggtattgacagtgaa
caaaccactgaagctgtgcaccatcaatttcaaactctttggcaaaggtacaagcgccaa
aagacacacccagaatatgagtctcaacttcaaaagatagagtcagaagttaaatggccc
agtcctggatcatttttttctataaaccttaaaatgcttgaccattctccttccctatgt
tcctctagtaattctaatcttagtgaaacagttaaagacattttaccaaacacattaata
agtccctgtgaaccagtttctaatttaacacatacaaacaaagaaaaacatttacagaca
aaagatgatttgaaagaaaccaggaaaagacttatttattctccattaaaggggactcct
ccaaaaagattgcgtgtggaaaatgaagacgttgatttagaaagtagttttaggtttgat
aatactatgaaaaattatttacgtccattcgactgttcaacacctaatcaacctaaaaaa
aaaccttcatcaccaacctcattaccaacctcatcaacatttgatcatcataacaataat
acagatattgatttcaaaagagttgatgttgtgaacggagcagtgtttaatgaggatcac
gatgaacttgttatagtaaaagatattgattttttttctatgtgcgagcatcatttagtt
acattttatggcaaagtccatgttgggtatttaccaaataagaaagtaattggaattagt
aaaattgcaagaattgtagaaatatttagtcgaagacttcaagttcaagagagactaacc
aagcaaattgcactagctttatttgaggctgtgagtccttctggtgttggtgttgttatt
gaagcttgtcacatgtgtatggtaatgagaggtgttcaaaaagttggagcttctactgtg
actagttgtatgctaggagcatttcgagatgacccaaaatctcgtaatgagtttctcaca
ttaattcgaaacaagtaa

DBGET integrated database retrieval system