KEGG   Hydra vulgaris: 100215739Help
Entry
100215739         CDS       T01080                                 

Definition
(RefSeq) GTP cyclohydrolase 1-like
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hmg  Hydra vulgaris
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100215739
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100215739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 236 aa AA seqDB search
MDEVFHINTCPDASEAIKNCENVNSVHLSYSNENTELHMRHRSDNPEEYNSNVSNIAESV
LKVIRGVGEDPNREGLLKTPERFAKAMLFFTKGYTENLQDVVNGAVFNEDHDELVIVKDI
DFFSMCEHHLVTFYGKVHVGYLPNKKVIGISKIARIVEIFSRRLQVQERLTKQIALALFE
AVSPSGVGVVIEACHMCMVMRGVQKVGASTVTSCMLGAFRDDPKSRNEFLTLIRNK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagtttttcatataaatacttgcccggatgcttcagaagccattaaaaactgt
gaaaatgttaatagtgttcatctcagttactccaatgaaaatacagaattgcatatgcgt
catcgatcagacaatccagaagaatacaatagcaatgtttcaaatattgctgaatctgta
ttaaaagttatccgtggtgtaggggaggatccaaatcgtgaaggactattaaaaacacca
gagagatttgcaaaagcaatgctgttttttaccaaaggatacactgaaaaccttcaggat
gttgtgaacggagcagtgtttaatgaggatcacgatgaacttgttatagtaaaagatatt
gattttttttctatgtgcgagcatcatttagttacattttatggcaaagtccatgttggg
tatttaccaaataagaaagtaattggaattagtaaaattgcaagaattgtagaaatattt
agtcgaagacttcaagttcaagagagactaaccaagcaaattgcactagctttatttgag
gctgtgagtccttctggtgttggtgttgttattgaagcttgtcacatgtgtatggtaatg
agaggtgttcaaaaagttggagcttctactgtgactagttgtatgctaggagcatttcga
gatgacccaaaatctcgtaatgagtttctcacattaattcgaaacaagtaa

DBGET integrated database retrieval system