KEGG   Hydra vulgaris: 100215891Help
Entry
100215891         CDS       T01080                                 

Definition
(RefSeq) protein unc-13 homolog A-like
  KO
K15293  
protein unc-13 A/B/C
Organism
hmg  Hydra vulgaris
Brite
Membrane trafficking [BR:hmg04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100215891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1542 aa AA seqDB search
MENDLHVVVKKAKAVFKDPGKVKTFLILQIDKTIIKTPVVVGSYPTWHQVFTFKVCGPNK
HLVIKFMKDGLIFQDLCGFVIIPLVDVHFSDKEGPGTWIPLYIEQNNKNIQTDYKLLIDM
RYALPQGLKPEEAQALSQKLAVLNNILDQEVKIIAEQHRRHISSSVTKLSSLENSFDSSE
HPKINGSKSTESLNTKSDFEKSKTSLGDDDIFISPNTEGGEITDEDRKIIFNQLRQLKNE
SQNDSEKQASAHNSDSEADKDMKLDAKRKFKKLQKSNPARRNWQKALDDIREARQSGIHS
NINDITEEHSARERVKSILQEPVILRERSRSAGDKNIFGCTPEEEEEKEDGGMDNSPKPQ
QDDFKFGRKINRRFGIRHSPRSSVRRQSDQFFNIDFSSEIKTRRNSIFGQALTNIMQRKS
QANFASPSVNDDELKIHVYKKTLQALIYPISSTTPHTFEKFSAQHPVYCYECENFLWGLA
RQGFKCSECGVKCHEKCRDLLNADCLQRAVEKSSKHGDETIAKAKLSHIRDKMERRCIEK
HDIFEMIRDMFMISEQDDVKYTDAVKQNILDGSSKWFAKISVTVHSAQNLIAKDKAGTSD
PYVTVQIGKTKKRTTTKPYNLNPVWDESFTFDCHNSSDRIKVRVWDEDYDLKARVRQKFT
REPDEFLGQTIIEVRTLSGEMDVWYNLGKRTDRSAVSGAIRLKISIEIEGEEKLVPYHKQ
YTCLHEILFQYLYEKNGNEVIIPKSSGDDAWKVYFTEPALEIVNEFAIRYGVEIIYQAMT
HFSCLAAHYNEPGVPAMMSTLLANINAFYAHTTATSASSAKNRFSNSNFGKARFEKILNQ
LHNQLRIDLCNYRTLFPASNEVRLSDLKSTVDLLTSITFFRMKVQEYNAPPRAAHVVTEC
VKNCIESNYKFIYSNCHVLSADTDKQNEDNTGTQTIEFWVKLIRLVVGIIEEDRDVYTNI
LDQFPSDLNVGELSAFKLWTMFGESLQEFLAEQEKLQTWTNTEYMNLYFKVKTFGKLIEH
VPEYKASPPMYIYWFEPFIMMWLDENDDLSMDYLYNAVDKDKNEGFEKQSEEFRFSFSVP
DIFLSLIQSLDIIKKLELPCLDMEKRLIDRFSQTVAQVLLRYCELIIQIFEKICRCHIVA
CILMNNVQQLRVQLQKLYESIGPEKMSEKTQSSFKELQQSLSQYLDDLSVLYATSVSEKI
QECCKLLNVQLIKIKGVGSNNMSNMEKQLLEKDAEDVMHALFVFMEENFPTYAKYCEKPV
LKRLLKELWKMVMNSIEKVIVLPPLPIDGVQADSHNLNPRQCKILEIVLEIVQNFFHARG
DGLKKSFLEKSPDIKSLHYALSLYSQTTDSLIKTFIETQDQQSAFAAEGCVGEIDIQIDL
FTYAASGEHKVTVKVVEAKNLLWQTKGVFRPFIEVNILGPHLTDKTKRNSTRSKNNNWSP
KFNEIMNFQLGNEDPLSCYELQISAKDYCFGRKNHLIGVTVLPLRNICNRGSFASWCALG
RSLYMNDTGWTILRILSQRTNDEIARDFVMLKFDRRIDAEMG
NT seq 4629 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgatttgcacgttgtagttaagaaagcaaaagcagtgttcaaagatccagga
aaagtgaaaacatttttaatccttcagatagataagaccattataaaaactcctgttgtt
gttggctcatatccaacatggcatcaagtatttacatttaaagtatgtggacccaacaag
catcttgttataaagtttatgaaagatggacttatatttcaagatttatgtggctttgtt
attattccacttgtggatgttcatttttcagataaagaaggaccaggcacttggattcca
ttatatattgagcaaaataacaaaaacatacagactgattataagcttcttattgatatg
cgatatgctctcccccaaggtttgaaaccagaagaggctcaagcattatctcagaaactt
gctgttttaaacaatatacttgatcaagaagttaaaattatagctgagcaacaccgtcgt
cacataagcagcagtgtcactaaactatcttcattagaaaattcttttgattcatcagaa
catcctaagatcaatggatcaaaaagcactgaatctttaaacacaaagtctgattttgaa
aagtccaaaacatctctgggtgatgatgatatatttatttcaccaaacactgaaggagga
gaaataacagatgaagaccgaaaaatcattttcaatcaattgagacagttgaaaaatgaa
agtcaaaatgatagcgagaaacaggcaagtgcgcataacagtgattcagaagctgacaaa
gacatgaaacttgatgcaaagcgaaaattcaaaaagcttcaaaaatcaaatccagctcgt
cgtaattggcaaaaagctttagatgatattagagaagctcgtcaaagtggaatacattca
aatattaatgacattacagaagagcattcagcgcgggaaagagttaaaagcatattacaa
gaacctgtcatattgcgtgaaagatctaggtcagcaggtgataaaaatatatttggatgt
actccagaagaagaagaagaaaaggaagatggtggaatggataattcacctaaaccacag
caggatgattttaaatttgggaggaaaattaatagaagatttggtattcgccattcacct
cgcagtagtgtgaggagacagtctgatcaatttttcaacattgatttttcttctgagatt
aaaacaagaagaaattcaatattcggacaagccctaaccaacattatgcaacgcaaatcc
caagctaattttgcttctccttctgtcaatgatgatgagctgaaaattcatgtttacaaa
aaaacactacaggctttgatatacccaatatcaagtacaactcctcatacatttgaaaaa
ttttcagctcagcatccagtttattgttatgagtgcgaaaattttttatggggacttgca
agacaagggtttaagtgctcagaatgtggtgtgaagtgtcacgaaaaatgtagagatttg
ttgaatgcagattgtcttcagagagctgttgaaaagtcatcaaaacacggtgatgaaacc
attgctaaagctaagctttctcatattcgagataaaatggaacgaaggtgtatagaaaag
catgatatatttgaaatgataagagacatgtttatgatatcagagcaagatgatgttaag
tatacagatgcagtaaagcaaaatatattggatggatcatcaaagtggtttgcaaaaata
tctgttacagttcacagtgcacaaaatctcatagcaaaagataaagcaggtacaagcgat
ccttacgttactgttcaaataggaaaaactaaaaaaagaacaactactaaaccatataac
ctgaatccagtgtgggatgaaagttttacatttgactgccataattcttcagatcgaata
aaagttcgtgtttgggatgaagattatgatttgaaggcaagagtgcggcagaagtttaca
cgagaacctgatgagttcttaggtcaaaccattattgaagttcgaactctaagtggagaa
atggatgtgtggtataatcttggaaagcgaactgatagatcagcggtatcaggtgccata
agactaaaaattagcatagaaattgaaggagaagaaaaattagtcccataccacaagcag
tatacttgccttcatgagatcttgtttcaatatctgtatgaaaaaaatggaaatgaagtg
ataatacctaagtcatctggcgatgatgcttggaaagtatattttactgaaccagcttta
gaaatagtgaatgagtttgcaatcagatatggagttgaaataatttatcaagcaatgaca
catttttcatgccttgctgcgcattataatgagcctggagttcctgcaatgatgagtaca
ttactggctaacattaatgctttttatgcacatactactgcaacttctgcttcttctgca
aaaaatagattttcaaattcaaattttggtaaagctcgctttgagaaaattttaaatcag
cttcacaatcaattgaggattgacttgtgcaattatagaacactttttcctgcatcaaat
gaagttcgactttcagatttaaaatcaactgtagacttacttacaagcataactttcttc
cggatgaaggttcaagaatataatgcacctcctcgagcagctcatgttgtcacagagtgt
gtgaagaactgcattgagtcaaactacaagtttatttattctaactgccatgtacttagt
gctgatacagataaacagaatgaagataatactggtacccaaactatagagttttgggtt
aaattaattcgtttagttgttgggattattgaagaagatcgtgatgtttacacaaatata
ttagatcaatttccatcagatttaaatgttggagagttaagtgcttttaagttgtggaca
atgtttggagaaagtcttcaagagtttttggcagagcaagaaaaacttcaaacatggaca
aatacagaatatatgaacttatattttaaggtcaaaacatttgggaaacttatagagcat
gttccagagtataaggcttcaccacctatgtatatttattggtttgaaccgtttattatg
atgtggttagatgagaatgatgatttgtctatggactatttgtataatgctgtcgataaa
gataagaatgagggatttgaaaaacagtcagaagaatttagattctctttttctgttcca
gatatttttctttcgctcattcagagcttagatattattaaaaaattggaactaccatgt
ttagacatggagaagaggttaatagatcgtttttctcagactgttgctcaagtattgctt
cgttattgtgagcttataattcaaatttttgaaaaaatatgtcgctgtcatatagtggca
tgtattttgatgaataatgtgcaacagctgcgagtacaacttcaaaaattgtatgaatct
attggacctgaaaaaatgagtgagaaaacacaatcatcttttaaagagcttcagcaaagt
ctttctcaatacctagatgacttaagcgtactttatgctacaagtgtttctgagaaaatt
caagaatgttgcaagttgttaaatgtacagttgatcaaaattaaaggtgtgggatctaac
aatatgtcaaatatggaaaaacaacttcttgaaaaagatgctgaggatgtcatgcacgct
ctttttgtttttatggaagaaaattttcctacatatgcaaagtattgtgaaaaacctgtt
ttaaaaagattattaaaggagttatggaagatggtgatgaacagcatagagaaagttatc
gtgttacctcctctgcctattgatggtgttcaagcagactctcacaatcttaaccctcgt
cagtgtaaaatattagaaattgttttagaaattgttcagaatttttttcatgcacgtggt
gacggtttgaaaaaatcattcttagaaaaaagtcctgatatcaaatcacttcattatgct
ttgtctctatattctcaaactacagactcacttattaagacgtttattgaaactcaagac
caacaaagtgcttttgctgcagaagggtgtgttggtgagattgatattcaaattgacttg
tttacttatgcagcatctggtgaacacaaagtcactgttaaagttgttgaagcaaaaaat
cttttgtggcaaacaaaaggtgtgtttcgaccttttatagaagttaacatacttggccct
catctgacagataaaactaaaaggaattctacaaggtcaaagaacaataactggtctcct
aaatttaacgagataatgaactttcaactaggaaacgaagatccactttcttgttatgaa
ctacaaatttctgcaaaagattattgttttgggcgtaaaaatcatttgattggagtaacg
gtattaccgcttcgcaatatatgtaaccgtggttcgtttgcttcgtggtgtgcattgggc
agatcactttatatgaacgatacaggatggactatattacgcattttgtcacaaaggact
aatgacgaaattgcgcgagattttgtaatgctaaaatttgaccgccgcatagatgcggaa
atgggttga

DBGET integrated database retrieval system