KEGG   Hydra vulgaris: 100215891Help
Entry
100215891         CDS       T01080                                 

Definition
protein unc-13 homolog B-like
Orthology
K15293  
protein unc-13
Organism
hmg  Hydra vulgaris
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1124 aa AA seqDB search
METDLAREEKKLRRLARVNTELQVITVKPEKNLRDTYTTDQFFNIDFSSEIKTRRNSIFG
QALTNIMQRKSQANFASPSVNDDELKIHVYKKTLQALIYPISSTTPHTFEKFSAQHPVYC
YECENFLWGLARQGFKCSECGVKCHEKCRDLLNADCLQRAVEKSSKHGDETIAKAKLSHI
RDKMERRCIEKHDIFEMIRDMFMISEQDDVKYTDAVKQNILDGSSKWFAKISVTVHSAQN
LIAKDKAGTSDPYVTVQIGKTKKRTTTKPYNLNPVWDESFTFDCHNSSDRIKVRVWDEDY
DLKARVRQKFTREPDEFLGQTIIEVRTLSGEMDVWYNLGKRTDRSAVSGAIRLKISIEIE
GEEKLVPYHKQYTCLHEILFQYLYEKNGNEVIIPKSSGDDAWKVYFTEPALEIVNEFAIR
YGVEIIYQAMTHFSCLAAHYNEPGVPAMMSTLLANINAFYAHTTATSASSAKNRFSNSNF
GKARFEKILNQLHNQLRIDLCNYRTLFPASNEVRLSDLKSTVDLLTSITFFRMKKNKLWY
NPTSWLHSVFAFNMCLDLVVEDEFLQDLKIFPSDLNVGELSAFKLWTMFGESLQEFLAEQ
EKLQTWTNTEYMNLYFKVKTFGKLIEHVPEYKASPPMYIYWFEPFIMMWLDENDDLSMDY
LYNAVDKDKNEGFEKQSEEFRFSFSVPDIFLSLIQTVAQVLLRYCELIIQIFEKICRCHI
VACILMNNVQQLRVQLQKLYESIGPEKMSEKTQSSFKELQQSLSQYLDDLSVLYATSVSE
KIQECCKLLNVQLIKIKGVGSNNMSNMEKQLLEKDAEDVMHALFVFMEENFPTYAKYCEK
PVLKRLLKELWKMVMNSIEKVIVLPPLPIDGVQADSHNLNPRQCKILEIVLEIVQNFFHA
RGDGLKKSFLEKSPDIKSLHYALSLYSQTTDSLIKTFIETQDQQSAFAAEGCVGEIDIQI
DLFTYAASGEHKVTVKVVEAKNLLWQTKGVFRPFIEVNILGPHLTDKTKRNSTRSKNNNW
SPKFNEIMNFQLGNEDPLSCYELQISAKDYCFGRKNHLIGVTVLPLRNICNRGSFASWCA
LGRSLYMNDTGWTILRILSQRTNDEIARDFVMLKFDRRIDAEMG
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgatttagctcgagaagaaaaaaagttgcgtcggttagcacgtgtgaataca
gaactccaagttatcacagttaaacctgagaaaaatctaagagatacttatacaactgat
caatttttcaacattgatttttcttctgagattaaaacaagaagaaattcaatattcgga
caagccctaaccaacattatgcaacgcaaatcccaagctaattttgcttctccttctgtc
aatgatgatgagctgaaaattcatgtttacaaaaaaacactacaggctttgatataccca
atatcaagtacaactcctcatacatttgaaaaattttcagctcagcatccagtttattgt
tatgagtgcgaaaattttttatggggacttgcaagacaagggtttaagtgctcagaatgt
ggtgtgaagtgtcacgaaaaatgtagagatttgttgaatgcagattgtcttcagagagct
gttgaaaagtcatcaaaacacggtgatgaaaccattgctaaagctaagctttctcatatt
cgagataaaatggaacgaaggtgtatagaaaagcatgatatatttgaaatgataagagac
atgtttatgatatcagagcaagatgatgttaagtatacagatgcagtaaagcaaaatata
ttggatggatcatcaaagtggtttgcaaaaatatctgttacagttcacagtgcacaaaat
ctcatagcaaaagataaagcaggtacaagcgatccttacgttactgttcaaataggaaaa
actaaaaaaagaacaactactaaaccatataacctgaatccagtgtgggatgaaagtttt
acatttgactgccataattcttcagatcgaataaaagttcgtgtttgggatgaagattat
gatttgaaggcaagagtgcggcagaagtttacacgagaacctgatgagttcttaggtcaa
accattattgaagttcgaactctaagtggagaaatggatgtgtggtataatcttggaaag
cgaactgatagatcagcggtatcaggtgccataagactaaaaattagcatagaaattgaa
ggagaagaaaaattagtcccataccacaagcagtatacttgccttcatgagatcttgttt
caatatctgtatgaaaaaaatggaaatgaagtgataatacctaagtcatctggcgatgat
gcttggaaagtatattttactgaaccagctttagaaatagtgaatgagtttgcaatcaga
tatggagttgaaataatttatcaagcaatgacacatttttcatgccttgctgcgcattat
aatgagcctggagttcctgcaatgatgagtacattactggctaacattaatgctttttat
gcacatactactgcaacttctgcttcttctgcaaaaaatagattttcaaattcaaatttt
ggtaaagctcgctttgagaaaattttaaatcagcttcacaatcaattgaggattgacttg
tgcaattatagaacactttttcctgcatcaaatgaagttcgactttcagatttaaaatca
actgtagacttacttacaagcataactttcttccggatgaagaaaaataagctttggtat
aacccaacatcttggcttcattcagtttttgcatttaacatgtgtcttgatcttgttgta
gaagacgaatttcttcaagatttgaaaatatttccatcagatttaaatgttggagagtta
agtgcttttaagttgtggacaatgtttggagaaagtcttcaagagtttttggcagagcaa
gaaaaacttcaaacatggacaaatacagaatatatgaacttatattttaaggtcaaaaca
tttgggaaacttatagagcatgttccagagtataaggcttcaccacctatgtatatttat
tggtttgaaccgtttattatgatgtggttagatgagaatgatgatttgtctatggactat
ttgtataatgctgtcgataaagataagaatgagggatttgaaaaacagtcagaagaattt
agattctctttttctgttccagatatttttctttcgctcattcagactgttgctcaagta
ttgcttcgttattgtgagcttataattcaaatttttgaaaaaatatgtcgctgtcatata
gtggcatgtattttgatgaataatgtgcaacagctgcgagtacaacttcaaaaattgtat
gaatctattggacctgaaaaaatgagtgagaaaacacaatcatcttttaaagagcttcag
caaagtctttctcaatacctagatgacttaagcgtactttatgctacaagtgtttctgag
aaaattcaagaatgttgcaagttgttaaatgtacagttgatcaaaattaaaggtgtggga
tctaacaatatgtcaaatatggaaaaacaacttcttgaaaaagatgctgaggatgtcatg
cacgctctttttgtttttatggaagaaaattttcctacatatgcaaagtattgtgaaaaa
cctgttttaaaaagattattaaaggagttatggaagatggtgatgaacagcatagagaaa
gttatcgtgttacctcctctgcctattgatggtgttcaagcagactctcacaatcttaac
cctcgtcagtgtaaaatattagaaattgttttagaaattgttcagaatttttttcatgca
cgtggtgacggtttgaaaaaatcattcttagaaaaaagtcctgatatcaaatcacttcat
tatgctttgtctctatattctcaaactacagactcacttattaagacgtttattgaaact
caagaccaacaaagtgcttttgctgcagaagggtgtgttggtgagattgatattcaaatt
gacttgtttacttatgcagcatctggtgaacacaaagtcactgttaaagttgttgaagca
aaaaatcttttgtggcaaacaaaaggtgtgtttcgaccttttatagaagttaacatactt
ggccctcatctgacagataaaactaaaaggaattctacaaggtcaaagaacaataactgg
tctcctaaatttaacgagataatgaactttcaactaggaaacgaagatccactttcttgt
tatgaactacaaatttctgcaaaagattattgttttgggcgtaaaaatcatttgattgga
gtaacggtattaccgcttcgcaatatatgtaaccgtggttcgtttgcttcgtggtgtgca
ttgggcagatcactttatatgaacgatacaggatggactatattacgcattttgtcacaa
aggactaatgacgaaattgcgcgagattttgtaatgctaaaatttgaccgccgcatagat
gcggaaatgggttga

DBGET integrated database retrieval system