KEGG   Hydra vulgaris: 100215955Help
Entry
100215955         CDS       T01080                                 

Definition
(RefSeq) choline kinase alpha-like
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
hmg  Hydra vulgaris
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100215955
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100215955
    2.7.1.82  ethanolamine kinase
     100215955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 400 aa AA seqDB search
MTRSRSSSVVSLSELKGDVEDKSLERAGDLIRLTKCEDADIISIAYKYCSKCLAGAWAKC
KPEKFTVNILNGGLTNYMYVCEVVDDVHFKPHEPRKVLLRIYGDIVDQKQRFYEGVIFTL
LSERGIGPKTFGVFNSGRIEEFIPFRDLFTTELADPMISTLIAKRLAEFHSINLPLSKEP
TFLWENMEKFIEVCSEITFEEETKQERFEKMKKKINVHLEYKWLRKMLTDLNSPVVFSHN
DLQEGNILYINTGDVNTDVKIVDYDYSSFNYRGYDFGNHFCEWMYEYKSHHENGFKVFYN
AYPSRSQQELFAQQYIKTTNEILNSFSENKIDHQKFKYDLTPCSVETLLDEGNKFALASH
FFWLLWSVIQARLSKICFGYLEYAEIRLEAYITHKKQIGF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacacgttcaagatcttcttctgtggttagtctttctgaactaaaaggggatgttgaa
gataaaagtttggagagagcaggcgacttaatccgtttaactaaatgtgaagatgctgat
attatttcaattgcatataaatattgctctaaatgtcttgccggagcttgggctaaatgt
aaaccagaaaagtttactgtcaatattctcaatggtggtttaacaaattatatgtatgtg
tgtgaagttgttgatgatgttcattttaaaccacatgagccaaggaaagttcttctgaga
atatatggagatattgtggatcagaaacaacgattttatgagggggttatttttactttg
ctctctgagcgtggaataggtccaaaaacctttggtgtctttaactctggaagaatagaa
gagtttataccatttcgggacttgtttacaacagagctagctgatcctatgatttcaaca
ttaatagctaagaggcttgctgagtttcattctataaacttaccattgagtaaagaacca
acatttctctgggaaaatatggaaaaatttatcgaagtttgctcagagataacatttgaa
gaagaaacaaagcaggaaagatttgaaaaaatgaaaaaaaagataaatgttcatcttgaa
tataaatggctacggaaaatgcttacagacttgaactctccagttgtctttagtcataat
gatttacaagaaggtaatattttatacatcaatactggagatgtcaacacagatgtcaaa
attgttgactatgattacagcagtttcaactacagaggatatgactttggtaatcacttt
tgtgagtggatgtatgaatacaaaagtcatcatgaaaatggttttaaggttttttataat
gcatatccgagcagatctcaacaggagttatttgctcagcaatatattaaaaccaccaat
gaaatattgaatagtttttcggaaaacaaaatcgaccatcaaaagtttaagtatgacttg
actccatgttcagttgaaactttgttggatgaaggaaataagtttgcgcttgcttctcat
tttttttggttactatggtcagttatacaagcacggttatcaaaaatttgttttggttat
ctggagtatgctgagattcgattagaagcttacatcactcataaaaagcaaatcggcttt
taa

DBGET integrated database retrieval system