KEGG   Hydra vulgaris: 101235289Help
Entry
101235289         CDS       T01080                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
hmg  Hydra vulgaris
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Insulin resistance
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101235289
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    101235289
   04068 FoxO signaling pathway
    101235289
   04070 Phosphatidylinositol signaling system
    101235289
   04150 mTOR signaling pathway
    101235289
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101235289
   04933 AGE-RAGE signaling pathway in diabetic complications
    101235289
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101235289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 344 aa AA seqDB search
MKTMTEYLHQCKDQSKEDKIEMMRNIFNGSSYKKAFSEIVSPLDPSIKLKCLRVEKCKYM
DSKKKPLWLVFENVDEGADDVVIIFKNGDDLRQDMLTVLSLRIMDNVWKKAGLDYGIIPY
RCLSTGPMLGLIEVVPESETLGKIQFARGAFGTWKDDTFFLWLKDQCQGSDEKLEKFIQN
FTRSVVGYSIATYVLGVGDRHNDNIMMKKDTGQLFHIDFGHFLGNFKTKFGFKRERVKFV
LTSDIVYVISKHMNIDDFKDMCIVAFKTLRSRGNLFITIFAMLLSTGIPELEHPNDIEYI
RESMALTKDEADAVKHFEMSYKEAYNNRASTTLNWSLHNVVHNW
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatgactgaatatcttcatcaatgtaaagatcaaagtaaagaagataaaata
gaaatgatgcgaaatattttcaatggatcaagttacaaaaaagctttttcagaaatagtg
tctccactagatccaagtattaaactgaaatgtctcagggttgaaaaatgcaaatatatg
gattctaaaaaaaaaccactttggctagtgtttgaaaatgttgatgaaggagcagatgat
gttgttatcatttttaaaaatggagatgatttgcgtcaagatatgttaactgtattatca
ttgcgaatcatggataatgtctggaagaaagctggacttgactatggtattattccatat
cgatgtctttctactggtccaatgctcggattaattgaagtggtaccagaatctgaaaca
ttaggtaagatacagtttgctcgtggtgcttttggtacatggaaagatgacacttttttt
ttgtggctgaaagaccaatgtcaaggatcagatgagaaattggaaaaatttatacagaac
ttcactagatcagttgttggttatagtattgctacatatgtgttaggagttggtgataga
cataatgataatataatgatgaagaaggatactggtcagttgtttcatattgattttgga
cattttctgggaaactttaagacaaagtttggattcaaaagagagcgagttaaatttgtt
ttaacttcagacattgtttatgtgattagcaaacatatgaatatagatgacttcaaggac
atgtgtattgttgctttcaagacgcttagaagtcgtggaaatttgttcattaccattttt
gcgatgctgctgtcgactggaattccagagcttgaacatcctaatgacatagaatacata
cgtgagtccatggcgttaacgaaagatgaagcagatgcggttaaacattttgaaatgtct
tacaaagaagcctacaataaccgagcttctactacattaaattggagtcttcacaacgta
gttcacaattggtaa

DBGET integrated database retrieval system