KEGG   Hydra vulgaris: 101235521Help
Entry
101235521         CDS       T01080                                 

Definition
mitogen-activated protein kinase 7-like
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
hmg  Hydra vulgaris
Module
MAPK (ERK5) signaling
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101235521
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101235521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 237 aa AA seqDB search
MSNQLRRHQKQVSFHVDSKYKILEIIGEGAYGVVCSALESTTGQRVAIKKICDIFDVPAI
TKRTLRELKILKFFKHDNIIAIKEILKPPDDIKLFKDVYVVLDLMGSDLHHIIHSKQDLS
EEHVRYFLYQILRGLKYIHSSNIIHRDLKPSNLLVNKDCELKIGDFGMARSLLSSPIEQK
RVMTEYVATRWYRAPELMLTVHQFTKAIDMWSVGCIFAEMLGRAALFPGSNYLNQLQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaattacgtagacatcagaaacaagtaagttttcatgttgattcaaagtat
aaaattcttgaaatcattggagagggagcgtatggtgtagtttgctcagcattagaaagt
acaacaggtcagcgtgtagctattaaaaaaatatgtgatatttttgatgtgcctgccata
acaaaaagaaccttaagagaattgaagattttaaaattttttaaacatgataatattata
gctatcaaggagatattaaaaccccctgatgatatcaaacttttcaaagatgtttatgtt
gttttggatttaatgggtagtgatttgcatcatattattcattcaaaacaagatctttca
gaagaacatgttcggtatttcctctatcaaatattgagaggtcttaagtatatacattct
tcaaatattattcatcgtgatttgaaaccaagtaatttgcttgttaacaaagattgtgag
ttgaaaatcggtgattttggcatggcaaggagtcttctatcttcacctattgagcaaaag
cgtgtaatgacagaatatgttgcaactcgctggtatcgagcaccagagctgatgcttact
gtgcatcaattcactaaagctattgatatgtggtcagtaggatgtatttttgcagaaatg
cttggtagagctgctctatttccaggaagtaattatcttaatcaacttcag

DBGET integrated database retrieval system