KEGG   Heliobacterium modesticaldum: HM1_0078Help
Entry
HM1_0078          CDS       T00653                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00010  Glycolysis / Gluconeogenesis
hmo00030  Pentose phosphate pathway
hmo00051  Fructose and mannose metabolism
hmo00052  Galactose metabolism
hmo00680  Methane metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
hmo01120  Microbial metabolism in diverse environments
hmo01130  Biosynthesis of antibiotics
hmo01200  Carbon metabolism
hmo01230  Biosynthesis of amino acids
hmo03018  RNA degradation
Module
hmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HM1_0078 (pfkA)
   00030 Pentose phosphate pathway
    HM1_0078 (pfkA)
   00051 Fructose and mannose metabolism
    HM1_0078 (pfkA)
   00052 Galactose metabolism
    HM1_0078 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HM1_0078 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HM1_0078 (pfkA)
Enzymes [BR:hmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HM1_0078 (pfkA)
Protein phosphatases and associated proteins [BR:hmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HM1_0078 (pfkA)
Messenger RNA biogenesis [BR:hmo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HM1_0078 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABZ82703
UniProt: B0TI30
Position
complement(67582..68544)
Genome map
AA seq 320 aa AA seqDB search
MVKHIGVLTSGGDAPGMNACLRAVVRMAIYRGIQVSGILRGYAGLLAGEMRAMDVGSVGD
IIHRGGTVLRTARCKEFFEPENQALAAGKLKDAGIDALVVIGGDGSFRGAQALMRHGIRI
VGIPGTIDNDIPGTDYTIGFDTAVNTVLDAINKIRDTATSHDRTNVIEVMGRRAGHIALL
AGLGGGAESILVPEVPFDLDEVCARLLRGHDRGKLHSIILVAEGAGSAVEIGKRIEEKTG
LETRVTILGHIQRGGNPTATDRIWASRMGAQAVEALLRGQSNIMLGVRKGELVEENLDKA
LTERNGLDEPLYRLAGVLSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggtcaaacatatcggcgtcctcacctcgggcggcgacgcgccgggaatgaacgcctgc
ttgcgcgccgtcgtccgcatggccatctaccgggggatccaggtgtccgggatcttgcgc
ggctacgccggactcctggcaggagagatgcgcgccatggatgtcggatctgtcggcgac
atcatccaccgcggaggcacggtgttgcgaaccgcccgctgcaaggagttttttgaacct
gagaaccaggcattggccgccggcaagctgaaagacgccggcatcgacgccctcgtcgtc
atcggcggcgacggctctttccgcggcgcccaggccttgatgcgccacggcatccgcatc
gtcggcatcccgggcaccattgacaacgacatcccaggcacagactataccatcggcttt
gatacagcggtgaacaccgtcctcgacgctatcaacaagatccgcgataccgccacctcc
catgaccggacgaatgtgatcgaggtgatgggccggcgtgccggccatatcgccttgctg
gcgggtttgggcggcggcgccgagtcgatcctagtgcctgaggtgccttttgacctcgat
gaggtctgcgcccgcctgctgcgcggccatgaccgaggcaagctgcattcgatcatcctc
gtcgctgaaggggccggcagcgctgtcgagatcggcaagcgcatcgaagaaaagacaggc
ctggaaacgcgggtgaccatcctgggccacatccagcgcggcggcaacccaacggcgaca
gaccggatctgggcctcccgcatgggcgctcaggcggtggaggcgctcctgcggggacag
agcaacatcatgctcggcgtgcgcaaaggagagctggtcgaggagaacctggacaaggcc
ttgacggagcgaaacggtcttgacgagccattgtaccggctggctggggtgttatccatt
taa

DBGET integrated database retrieval system