KEGG   Heliobacterium modesticaldum: HM1_0669Help
Entry
HM1_0669          CDS       T00653                                 

Gene name
folB
Definition
folate synthesis, bifunctional protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HM1_0669 (folB)
Enzymes [BR:hmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HM1_0669 (folB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     HM1_0669 (folB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1327386..1328255
Genome map
AA seq 289 aa AA seqDB search
MDQTDRILLKGMSFYGYHGALPEEQVLGQPFTVDLELAVDLRQAGKSDAVQDSVHYGEVY
NRVRAILEGPPRATIEAVAEAVVVAVYRDFPAVQGLKVRVEKPKAPVPGLFQSMAVELNR
PAPARCFIGLGSNMGDRAANLTEALRRLQRRPGVAVIDHSSWYATKPVGFVDQDEFLNGA
AALLSWLSPQELLALLLETERAMGRVRLMKWGPRLIDLDLLLYDDAVIEEEHLTVPHPFM
VERGFVLAPLAEIAPEHRHPGGQTIRQLLEQLPSRADVVLHDPKSSITI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaccagacggatcgcatcctgctcaagggcatgtccttttacggctaccacggcgcc
ttgccggaggagcaggtgttgggacagccctttacggtggatctggaactggccgttgac
ctgcgccaggccggcaagagcgatgccgtgcaagactctgtccactacggcgaggtctac
aaccgggtgcgcgcgatcctggagggtccgccccgagcgacgatcgaggcggtcgccgag
gccgtcgtcgtcgctgtctaccgagattttcctgccgtccagggcctgaaggttcgtgtc
gagaagccgaaagcgccggtgccgggactcttccagtccatggccgtcgagttgaaccga
ccggcgccggcccgctgttttattggattgggcagcaacatgggtgaccgggcggcgaac
ctgaccgaggcgttgcgccggcttcagcgaaggcccggcgtggctgtcatcgaccactcc
tcctggtacgccacgaaaccggtcggtttcgtcgatcaggatgagtttctcaacggcgcc
gccgcattgctctcttggttgtcgccacaggaactcctggcgctgttgttagagacggaa
cgggccatggggcgggtgcgcctgatgaagtggggacctcgcctgatcgacctcgacctg
ctcctctatgacgacgctgtcattgaagaggagcatttgacggttccccacccgtttatg
gtcgaacggggcttcgtgcttgctccattggctgagatcgcccccgaacaccgccatccc
ggcgggcagacgataaggcaacttctggaacagctgccttccagagcagatgtggtattg
catgacccgaagagctccattacaatataa

DBGET integrated database retrieval system