KEGG   Heliobacterium modesticaldum: HM1_0670Help
Entry
HM1_0670          CDS       T00653                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HM1_0670 (folP)
Enzymes [BR:hmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HM1_0670 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1326080..1327288
Genome map
AA seq 402 aa AA seqDB search
MAFAGEGVTIKTVQIIEVRDKEDLWRLLDSIGCDPAGTAIMAEKGVHRILRVNGVPAKAA
NLLKQELLARGGDCAVRRQTCVLTVEETDCILMGTERQYRDLCRKLRMQPFGLKGLADRI
EGALRRYDRQEPHCLDCRGKKLVVGERTLVMGILNLTPDSFSDGGSYPEVRDALRRMEEM
VAEGADIIDVGAESTRPGATALTAEEELERLMPFLREIIPNCPVPVSIDTYKAATARQAL
EAGAHIINDIWGLQFDQDMAAVAAAYGAPVVVMHNRRNTDYADLMGEIVAFLEGSVHIAE
TAGIPPEAIIVDPGIGFGKTYEQNLDVMNRLGELRVLGKRILLGTSRKSLIARTLDLPPH
DRVEGTLATTVLGITKGVDIIRVHDVRANVRAARMADAMVRR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttggcatttgcaggggagggagtcaccatcaagacggtacagatcatcgaagtccgcgac
aaggaagacctgtggcggttgctcgacagcatcggctgcgatcccgccggcacggctatt
atggccgaaaaaggggttcaccgcatcctccgtgtcaacggcgttcccgccaaggcagcc
aacctgctcaagcaggagttgctggcccgcggcggcgactgcgccgtgcggcggcaaacc
tgtgtcctgaccgtcgaggagacggactgcatcctcatgggcacggaacggcaataccgc
gacctttgccgcaagctgcgcatgcagcccttcggactgaaggggctcgccgaccggatc
gagggggcccttcggcgatacgacagacaggagccccattgcctagactgccggggaaaa
aagctggtcgtcggcgagaggaccctggtcatgggcattcttaacttgacgccggacagt
ttttctgacggcggttcctatccggaggttcgcgacgccttgcggcggatggaggagatg
gtggcggaaggggccgatatcatcgatgtgggcgctgaatcgacgcgtcccggcgccaca
gcgctgacagcggaagaagagctggaacggctgatgccctttttgcgcgagatcatcccc
aactgccctgtgcccgtctccatcgacacctacaaagcggcgacggcgcggcaggcgctg
gaagcgggcgcccatatcatcaacgacatctggggtttgcagtttgaccaggacatggcc
gccgtggccgccgcatacggcgcgcccgtcgtggtgatgcataaccgccgcaatacagac
tatgccgatctgatgggcgagatcgtcgccttcttggaagggagtgtccatatcgccgaa
acagcggggatcccgccggaggcgatcatcgtcgatcccggcatcggcttcggcaagacc
tatgaacagaacctcgatgtgatgaaccggctcggggaactgcgggtgctcggcaaaagg
atcctgctcggcacatcgcgcaagtccctcatcgcccgcaccctcgatctgccgccccat
gaccgcgtcgaggggaccttagccacgacggttctcggcatcaccaagggcgttgacatc
attcgggtccatgacgtgcgggccaacgtgcgggcggcccgcatggctgacgccatggtc
cgtcggtaa

DBGET integrated database retrieval system