KEGG   Heliobacterium modesticaldum: HM1_0682Help
Entry
HM1_0682          CDS       T00653                                 

Gene name
bchH
Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HM1_0682 (bchH)
Enzymes [BR:hmo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HM1_0682 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1306962..1310855
Genome map
AA seq 1297 aa AA seqDB search
MSKKVMRFVHVYLERQICSAFSRAIEMSNRTQPIEISVTSFCVHELKEKVKIEEFRRAVL
NADLLFVGHVFVDDIARTIADVIRKEGQQVPTVVCVNAMPELMKLTRMGGFKMGSEQSNE
YMNIIKRFKKTIDTEEAQSKKSGPPINTDVMMTLVRTVPKLLKYIPGKMQDLRSYMLCYL
YWLNGSPKNLGNMLLMLAKQYFAPEADISFDAPVEYAEEGIYHPDSDRWFTSRAEYEEWY
RRHAPSELRVGLIVLRTSLLADNHDHYDAVIRALEAKGLGVVPGIAKGLDYRHVVEHMFM
GKGDVRKVDGVISLTSFSLVGGPASNDAESAVKVLSALGVPYLSAIPLEFQTIDEWKSDL
SGLNPVQVALNVAIPELDGLVGPTVYSGYAVHGASKAIPIPERIELLTERMRRMIRLRTT
AKADKKLAIVIFSFPPDKGNVGTAAYLDVFKSLYNLLRRLDEEGYSVELPESPEGLIKMI
VDDETSMLPSANLHVGGRITVEEYEKINPYWKEIAETWGPAPGELNTDGQDLLVFGRRLG
NVFIGVQPSFGYESDPIKLLFTRNACPHHGFAAFYRWLDKVYQADALLHFGTHGALEFMP
GHQVGMTESCWPDRLLGPVPNFYLYSVNNPSEATIAKRRSAATLVSYLTPPAENAGLYKD
LRDLKDLINMWGENRHNARGESILETIIEKVLALHLDKDVPLTKEPGQEFIGKLYVYLTD
LENRLIPTGLHILGEAPHAQTLGDYLSAISYFDRPEKGIRSLAGLASEAMGIPFSELERR
AELGEQAAIEKLEVVRQAVQHGVQRMIAEFLQKDERGRFSFLRGKAETLAAKAMQEFLLD
RVQTGLEVDIATAARTFVYLQDVLKDIVLAEEVDGLIKALDGEYIKPGPGGDPVRNPKTL
PTGHNIHALDPQAIPTSVAVRAGQRVAEMMLQKLYDANGVYPESIAVVLWGTDNIKTYGE
GIAQAMALMGVKPVPDDLGRMTRLRLIPLEELGRPRIDVVVTVSGIFRDLFQNQMELLDE
AVKMAATADEPLELNYIRKHAIAQAEEMNISIEQAATRVFSNAPGSYGGNVNQMVENSAW
EEAGELADTFIKRKGFAYGKQVRGEVADEIYRSALSNVDTSFQNVDSSEVGIVDIDHYYE
YLGGVSAAVKSIRGEKPNVLVADTTTPKVQIRYLEEMVRFETRTKTLNPKWYEGMLKHGY
EGVREIQSRVDNTFGWSATTDAVDNWVYDEITDVYITDETMRNRLKELNAHALRGIVRRL
LEANRRGFWEADEEKLDKLMEIYQDIEDEIEGVSVPA
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaaggtcatgcggtttgtccatgtctatctggagcggcagatttgcagcgcc
ttcagccgggccatcgagatgagcaatcgcacccaacccatcgagatcagcgtcacctcc
ttttgcgtgcacgagttgaaagagaaggtcaagatcgaagagtttcgccgggccgtgctg
aacgccgacctgctcttcgtcggccacgtctttgtcgacgacatcgcccgcaccatcgct
gacgtgatccgcaaggaaggtcaacaggtgccgacggtcgtgtgcgtcaacgccatgccg
gagctgatgaagctgacccgcatgggcgggttcaagatgggcagcgaacagtccaacgaa
tacatgaacatcatcaagcgcttcaagaagaccatcgacacggaagaggcgcaatcgaaa
aaatccggtccgcccatcaacaccgacgtgatgatgaccctcgtccgcaccgtgcctaag
ctgttgaaatacatacccggcaagatgcaggacctgcgctcctacatgctctgctacctc
tactggctcaacggatcgcccaaaaacctgggcaacatgttgctcatgctggccaagcag
tactttgcgcccgaagcggacatctcttttgacgcgcctgttgagtatgccgaagagggg
atctaccaccccgattcggatcgttggttcaccagccgcgccgagtatgaggagtggtat
cgccgtcacgcgccctccgagttgcgcgttggcctgatcgtcctgcgcacgagcctgctg
gcagacaaccatgatcactatgacgctgtcatccgcgcccttgaagcaaaaggccttggc
gtcgtccccggcatcgccaaaggtctcgactaccgccatgtggtggagcatatgttcatg
ggcaaaggggatgtgcgcaaggtcgacggcgtgatctccctcacctccttcagcctcgtc
ggcggtcctgcttccaacgacgccgaaagcgccgtcaaggtcctctcggcccttggtgtg
ccctacctgtcggcgatcccccttgagttccagaccatcgacgagtggaagtccgacctg
tctggcctgaacccggtccaggtcgccttgaacgtcgccatccccgagctggacggtctc
gtcggccccaccgtctacagcggctacgccgtccacggcgcctccaaggccatccctatt
ccggagcggatcgaactgctcacggagcggatgcggcgcatgatccggctccgcaccacg
gcgaaggccgacaaaaagctggccatcgtcatcttcagctttccgccagacaaggggaac
gtggggacggcggcttatctcgatgttttcaaatccctctacaacctgcttcgccgcctt
gacgaagaggggtattcggtcgagcttcccgagagcccggaagggctgatcaagatgatc
gtcgacgacgaaacgtccatgctgccctcggccaacctgcatgtgggcggtcgcatcacc
gtcgaagagtacgagaagatcaacccttactggaaagagatcgccgagacctggggaccg
gcgccgggcgaactgaacacggacggtcaggacctgctcgtctttggccgccgcctcggc
aacgtttttatcggtgtgcagccttccttcggctatgagagcgaccccatcaaactgctc
ttcacccgcaacgcctgtccccaccacggcttcgccgccttctaccgctggctcgacaag
gtctatcaggccgatgcactgctccacttcggcacccacggtgccttggagttcatgcct
ggtcaccaggtgggcatgaccgagtcctgctggcccgaccgcctgttggggccggtgccc
aacttctacctctatagtgtcaacaacccctctgaggcgaccatcgcgaagcggcggagc
gccgccaccctcgtctcctacctgacgccgccggctgagaatgccggcctctacaaggac
ctgagggacttaaaagacctgatcaacatgtggggagagaatcgccataacgcccgcggc
gagtccatcttggagacgatcatcgaaaaagtcctggccctgcacctcgacaaagacgtg
ccgctgacgaaagaaccgggccaggagttcattggcaagctctatgtctacctgaccgac
ctggaaaaccgcctcatcccgacgggcttacatatcctcggcgaggcgccccacgcccag
acgctcggcgactacctctcggccatcagctacttcgaccgccccgaaaaaggcatccgc
tccctggccgggttagcctctgaggccatgggcatccccttcagcgaactggaacggcgc
gccgaactgggcgagcaggcggcgattgaaaagctggaggtggtgcgccaggcggtgcag
cacggcgttcaaaggatgatcgccgagttcctccaaaaagacgagcggggccgcttcagc
ttcctgcgcggcaaggcagagacgctcgccgctaaggccatgcaggaattcctccttgac
cgcgtgcagaccggcttggaggtcgacatcgccacggctgcccgcaccttcgtctacctg
caagatgtcctcaaggacatcgtcctggccgaagaggtcgacggcctgatcaaggccctc
gacggcgagtacatcaagccgggaccgggcggcgaccctgtgcgcaacccgaagacgctg
ccgaccggtcacaacatccatgccctagatccccaggcgatccccacctccgtcgctgtc
cgcgccggccagcgggtcgccgagatgatgctgcaaaaactctatgacgccaatggtgtc
tatcccgagtcgattgccgtcgtcctctggggcaccgacaacatcaagacctacggcgaa
ggcatcgctcaggcgatggccctgatgggcgtcaaaccggtgccggacgatctgggccgc
atgacccgcctgcgtctcatcccccttgaggaactgggtcggccccgtatcgacgtggtc
gtcaccgtctcaggcatcttccgcgacctcttccagaatcagatggaactcctcgacgag
gccgtcaagatggccgccaccgctgacgagccccttgagctgaactatatccgcaagcac
gccatcgcccaagctgaggagatgaacatctccatcgaacaggccgccacgcgcgttttt
tctaatgcgccgggcagctacggcggcaacgtgaaccagatggtcgaaaacagcgcctgg
gaagaagccggcgaactggccgacaccttcatcaaacgcaagggttttgcctacggcaaa
caggtgcgcggcgaggtggccgacgagatttaccgctccgccctctccaatgtggatacg
agcttccaaaacgtagactcctctgaggtgggcatcgtcgacatcgaccactactacgag
tacctgggcggcgtttcggcggctgtgaagagcattcgcggcgaaaagcccaatgtgctc
gtcgccgatacgacgacaccgaaggtgcagatccgctacttggaagagatggtccgcttc
gagacgcggacgaagaccctcaaccccaagtggtatgaaggcatgctcaagcacggctac
gaaggcgtccgggagatccagtctcgcgtcgacaataccttcggttggagtgccaccacg
gacgccgttgacaactgggtctatgacgagatcaccgacgtctacatcaccgatgagacg
atgcgcaaccgcctgaaggaactgaacgcgcacgccttgcgcgggatcgtccgccgactt
ttggaggccaaccgccgcggcttctgggaagccgacgaagagaagctcgataaattgatg
gagatctaccaggacatcgaggatgagatcgaaggggtcagtgttccggcttga

DBGET integrated database retrieval system