KEGG   Heliobacterium modesticaldum: HM1_0684Help
Entry
HM1_0684          CDS       T00653                                 

Gene name
bchI
Definition
magnesium chelatase ATPase subunit i
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HM1_0684 (bchI)
Enzymes [BR:hmo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HM1_0684 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1303860..1304957
Genome map
AA seq 365 aa AA seqDB search
MTQAQPSNHSDRRQPAQIKVPTYPFTAIIGQEEMKLALILNVIDPRIGGVMIMGDRGTGK
STTVRALAELLPEVPSVADCPFGCHPEKTSEMCPSCRERMAEGEALPITYRKTRVVDLPL
GATEDRVCGTIDIQKALAEGVKAFEPGLLAQANRGFLYVDEVNLLDDHLVDVLLDSAASG
VNVVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGLHAQIRTLRDAQKRVAIIRSR
SDFDNDPESFIEKFHAPQAELQAKISRAKEILGDVTIGDEVLLKIAQLCIDLEIDGHRGE
LVLARTAKALAAFEGRTEVCDDDVARIAVLGLRHRLRKDPLATMDNGRRVQEKVAQIFGV
EKAGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagcgcaaccatcgaaccatagcgatcggcggcagccggcgcagatcaaagtg
ccgacctatccctttacggcgatcatcggccaggaagagatgaaactggccctcatcctg
aacgtgatcgacccgcgcatcggcggcgtcatgatcatgggcgatcgggggacgggcaag
tcgacgacggtccgcgcgctggctgaactgctgccggaagtgccttcggtggccgattgt
cccttcgggtgccacccggaaaaaacaagcgagatgtgccccagctgccgcgaacggatg
gcagaaggggaagcgctgcccatcacgtaccgcaagacccgcgtcgtcgacctcccgctg
ggcgcgacggaagaccgcgtctgcggcaccatcgatatccagaaggccttggccgaaggg
gtcaaagcctttgaaccgggcctcttggcccaagccaatcgcggtttcctctatgtggac
gaggtcaacctcctcgacgaccacctcgtcgacgtcctcctcgacagcgccgcctccggc
gtcaacgtggtcgaacgggaagggatcagcatccgccacccggcccgcttcgtcctcgtc
ggttcgggcaacccggaagaaggggaactgcgtccccagctgctcgaccgtttcggcctc
catgcccagatccgcaccttgcgcgacgcccagaagcgcgtcgccatcattcgcagccgc
agcgatttcgataacgacccggagagcttcatcgaaaaattccatgcgccccaggcggaa
ctgcaggccaagatcagccgggccaaagagatcctgggcgatgtgaccatcggcgatgag
gtgctcttgaagatcgcccagctctgcatcgacctggagatcgacggccaccggggcgag
ctggtcttggcccggacagccaaagccctcgctgcctttgaaggccggacggaggtctgt
gacgacgatgtagcccgcattgccgtcctcggactgcgccaccgcttgcgcaaggatccg
ctggcgacaatggacaacggccgccgcgttcaagaaaaagtggcccagattttcggagtt
gagaaggcgggagcatga

DBGET integrated database retrieval system