KEGG   Heliobacterium modesticaldum: HM1_0684Help
Entry
HM1_0684          CDS       T00653                                 

Gene name
bchI
Definition
(GenBank) magnesium chelatase ATPase subunit i
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00860  Porphyrin and chlorophyll metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HM1_0684 (bchI)
Enzymes [BR:hmo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HM1_0684 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 AAA_16 MCM Sigma54_activat AAA_29 DUF815 AAA AAA_30 AAA_18 AAA_28 ABC_tran FtsK_SpoIIIE AAA_7
Motif
Other DBs
NCBI-ProteinID: ABZ83868
UniProt: B0TBM9
Position
1303860..1304957
Genome map
AA seq 365 aa AA seqDB search
MTQAQPSNHSDRRQPAQIKVPTYPFTAIIGQEEMKLALILNVIDPRIGGVMIMGDRGTGK
STTVRALAELLPEVPSVADCPFGCHPEKTSEMCPSCRERMAEGEALPITYRKTRVVDLPL
GATEDRVCGTIDIQKALAEGVKAFEPGLLAQANRGFLYVDEVNLLDDHLVDVLLDSAASG
VNVVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGLHAQIRTLRDAQKRVAIIRSR
SDFDNDPESFIEKFHAPQAELQAKISRAKEILGDVTIGDEVLLKIAQLCIDLEIDGHRGE
LVLARTAKALAAFEGRTEVCDDDVARIAVLGLRHRLRKDPLATMDNGRRVQEKVAQIFGV
EKAGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagcgcaaccatcgaaccatagcgatcggcggcagccggcgcagatcaaagtg
ccgacctatccctttacggcgatcatcggccaggaagagatgaaactggccctcatcctg
aacgtgatcgacccgcgcatcggcggcgtcatgatcatgggcgatcgggggacgggcaag
tcgacgacggtccgcgcgctggctgaactgctgccggaagtgccttcggtggccgattgt
cccttcgggtgccacccggaaaaaacaagcgagatgtgccccagctgccgcgaacggatg
gcagaaggggaagcgctgcccatcacgtaccgcaagacccgcgtcgtcgacctcccgctg
ggcgcgacggaagaccgcgtctgcggcaccatcgatatccagaaggccttggccgaaggg
gtcaaagcctttgaaccgggcctcttggcccaagccaatcgcggtttcctctatgtggac
gaggtcaacctcctcgacgaccacctcgtcgacgtcctcctcgacagcgccgcctccggc
gtcaacgtggtcgaacgggaagggatcagcatccgccacccggcccgcttcgtcctcgtc
ggttcgggcaacccggaagaaggggaactgcgtccccagctgctcgaccgtttcggcctc
catgcccagatccgcaccttgcgcgacgcccagaagcgcgtcgccatcattcgcagccgc
agcgatttcgataacgacccggagagcttcatcgaaaaattccatgcgccccaggcggaa
ctgcaggccaagatcagccgggccaaagagatcctgggcgatgtgaccatcggcgatgag
gtgctcttgaagatcgcccagctctgcatcgacctggagatcgacggccaccggggcgag
ctggtcttggcccggacagccaaagccctcgctgcctttgaaggccggacggaggtctgt
gacgacgatgtagcccgcattgccgtcctcggactgcgccaccgcttgcgcaaggatccg
ctggcgacaatggacaacggccgccgcgttcaagaaaaagtggcccagattttcggagtt
gagaaggcgggagcatga

DBGET integrated database retrieval system