KEGG   Heliobacterium modesticaldum: HM1_0809Help
Entry
HM1_0809          CDS       T00653                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hmo  Heliobacterium modesticaldum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hmo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1187109..1187708
Genome map
AA seq 199 aa AA seqDB search
MRYYAEPVGRLIEELSKLPGVGPKTAQRLAFHLLHVPRNEAVALAKAIVEAHDKTLYCSV
CTNLTDRDPCRICSDANRDRAVICVVEEPRDVVAVEKTREYRGHYHVLHGALSPIEGVGP
EQLRISQLMARLADPELKEVIVATNPTVEGEATAAYLARLIKPMGVKVTRIAHGLPVGGD
LEYADQVTLLRAMEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgctactatgcggaaccggtcggacggctgattgaggaactgtccaaattgccgggg
gtgggaccgaaaacggcccagcggctcgcctttcatctgctccatgtaccgcggaatgaa
gccgttgccctcgccaaggccatcgtggaggcccatgacaagaccctctactgctccgtc
tgcacgaacctgactgaccgcgacccgtgccggatctgcagcgacgcgaaccgggaccga
gctgtcatctgtgtcgtcgaggagcctcgtgacgtggtagccgtagaaaagacgcgggag
taccgcggtcattaccatgtgctccacggtgccctgtcacccatcgagggcgtcggtccc
gagcagctgcggatcagccaactgatggcccggctggccgatccggagctaaaggaagtg
atcgtcgccaccaaccccactgtcgagggggaagcgacggcggcctacctggcgcggctg
atcaagcccatgggcgtcaaggtgacgcgcatcgctcacggcctgccggtgggcggcgac
ctggagtacgccgatcaggtgacgctgctgcgggcgatggaaggccggcgcgagttgtag

DBGET integrated database retrieval system