KEGG   Heliobacterium modesticaldum: HM1_0998Help
Entry
HM1_0998          CDS       T00653                                 

Gene name
aor
Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00030  Pentose phosphate pathway
hmo01100  Metabolic pathways
hmo01120  Microbial metabolism in diverse environments
hmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HM1_0998 (aor)
Enzymes [BR:hmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     HM1_0998 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABZ83570
UniProt: B0TA33
Position
complement(992692..994488)
Genome map
AA seq 598 aa AA seqDB search
MDAYVGKVLRINLSEQTIKCEPLNVEAAKKFIGGRGLGSYLLSQEIDPAIDALSPENKVF
IMTGPLTGTNAPTGGRYMVITKSPLTGAIACSNSGGFWGPELKNAGYDIVVLEGKSEKPV
YISIQDDKVEIRDAAHLWGMKVNEATDRLLEEAGDPKARVLCIGPAGENLSPMAAVMNDR
FRAAGRSGVGAVVGSKNVKAIVVRGSGKVQLADAERMKGILKGVMAKIRENGVTGQGLPT
YGTAVLVNIINESGVFPTRNFQTGVFDDAEAISGETLAEKYLLKKDPCYRCPIACGRYTK
ADEMEGGGPEYETIWCFGSDCGVNDMKAIIKANHLCNEYGLDTISAGATIACAMELFEKG
YIKAEEVDGPELTWGNADAIVEWTKKMGAAEGFGAKLAMGSYRLAESYGVPEYSMTVKKQ
ELPAYDPRGIQGHGVQYATSNRGGCHVRGYMISPEILGLPEKLDRFSLEGKPLWAKIFQD
LTASIDSAGMCLFTSFALGASDYADLLSAATGVEWTADEVLAAGDRIYNLERLFNMRAGL
TKADDTLPKRLLEEPLPEGPSKGWVHKLDELLPLYYEARGWDADGVPTKEKLQALGLE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttatgtaggcaaggtgctacgcatcaatctgtcggaacagacgatcaagtgc
gaacccctcaatgtggaagcggcgaaaaagttcatcggtggccgaggtctcggcagttat
ctgctgtcccaagagatcgatcctgccatcgatgccctgagccctgagaacaaagtcttc
atcatgaccggccccttgaccggcacgaatgcacccacaggcgggcgttacatggtgatc
accaagtcgcccttgaccggcgccatcgcctgctccaactcgggtggtttctggggaccg
gagttgaagaacgctggctatgacattgtcgtcttggaaggcaagtcggaaaagcccgtc
tacatcagcatccaagacgacaaggtggagatccgcgacgctgctcatctctgggggatg
aaggtcaacgaagcgacggacaggttgctggaagaggcgggcgatccgaaggcccgcgtc
ctctgtatcggcccggccggggaaaacctctcgcccatggcggcggtgatgaatgaccgc
ttccgcgccgccggccgttccggcgttggcgctgttgtcggctcgaagaacgtcaaggcc
atcgtcgtgcgcggctctggcaaggtgcaattggccgacgcggagcggatgaagggcatc
ttgaagggcgtcatggccaaaatccgggaaaacggcgtcaccggacagggcctccccacc
tacggcacggccgtgctcgtcaacatcatcaatgagagcggcgtcttccctacgcgcaac
ttccagacgggcgtctttgacgatgccgaagccatctccggcgagacgctggccgagaaa
tacctcctgaaaaaggatccctgctaccgttgtcccatcgcttgcggccgctacaccaag
gccgatgagatggaaggcggcggaccggagtacgaaaccatttggtgtttcggctccgac
tgtggcgtcaacgatatgaaggcgatcatcaaggccaaccacctctgcaacgagtacggc
ctggataccatctcggctggtgccaccatcgcctgcgccatggagctctttgaaaagggc
tacatcaaggccgaggaagtggacggaccggaactgacctggggtaacgccgacgccatc
gtcgagtggacaaagaagatgggcgctgctgaaggtttcggcgccaagctggccatgggc
tcttaccgcctggccgagtcctacggcgtccccgagtattcgatgaccgtcaagaagcag
gagctgccggcttatgacccgcgcggcatccaggggcacggcgtccagtacgccacgtcc
aaccggggcggctgccacgtccgcggttacatgatctcgccggagatcctgggcctgccg
gaaaaactggaccgcttctccctggaaggcaagccgctttgggcgaagatcttccaggac
ctgaccgcttctattgactccgccggtatgtgcctcttcacctccttcgccctcggcgcc
agcgactacgccgatctgctgagcgcggccacaggcgttgagtggacggccgatgaggtg
ctggcagccggcgatcgcatctacaacctggagcgccttttcaacatgcgggccgggctg
acgaaggccgatgacacgctgccgaagcgcctgctggaagagccgctgccggaaggcccc
tctaagggctgggtgcataagctcgacgagctgctgcccctctattacgaggcccgcggt
tgggacgccgacggtgtgccgacgaaggagaaattgcaagcgctggggctggaatag

DBGET integrated database retrieval system