KEGG   Heliobacterium modesticaldum: HM1_1596Help
Entry
HM1_1596          CDS       T00653                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hmo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611798..1613312
Genome map
AA seq 504 aa AA seqDB search
MSDSMSKKYVMALDQGTTSCRAILFDKDSNIVAVAQKEFTQIYPKAGWVEHNADEIWSTQ
YGVIAELLAKTGISAEEIASIGITNQRETTVVWEKATGKPVYNAIVWQCRRTTAICDELK
ARGLEQTFRTKTGLVVDAYFSGTKVKWILDNVEGAREKAEKGELLFGTMDTWLIWKLTAG
KVHVTDYSNASRTLMYNIRDLKWDEELLAALNVPASMLPEVKPSSEVYGYTDTALFFGHA
VPIAGAAGDQQAALFGQACYAPGMAKNTYGTGCFMLMNTGSELYDSKNGLLTTIAWGIEG
KVEYALEGSIFIAGAAIQWLRDGLKLIEAAPDSEYFAGKVDDTDGVYLVPAFAGLGAPYW
DMRARGAIVGLTRGTTKAHIVRAALEALAYQTKDVLGAMEADSNIKLQALKVDGGAVANN
LLMQFQADILGVPVERPRIIETTALGAAYLAGLAVGFWESKEELAKRWQLDNRFEVKMAD
EKRAKLYGGWKRAVTRSMDWERED
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggattcgatgagcaagaagtacgttatggcgctggaccaaggcaccacaagctgt
cgcgctatcctttttgacaaagacagcaacatcgtcgccgtagcccaaaaggaattcacc
cagatctatcccaaagccggctgggtcgagcacaacgccgatgagatctggagcacccag
tacggtgtcatcgccgaactgctggccaagacgggcatcagtgccgaagagatcgcctcc
atcggcatcaccaaccagcgtgaaacgacggtcgtctgggaaaaagctaccggcaaaccg
gtctacaacgccatcgtctggcaatgtcgccgcaccaccgccatttgcgacgaactgaaa
gcccgcggcctggaacaaaccttccggaccaagaccggccttgtcgtcgacgcctacttc
tccggcaccaaggtcaagtggatcttggacaacgtggaaggcgcgcgggaaaaagccgaa
aaaggcgagctgctcttcggcaccatggacacctggctgatctggaagttgactgccggc
aaggtccatgtcaccgactactctaacgcctcccgcaccctgatgtacaacatccgcgat
ctgaagtgggatgaggaactgctggccgccctgaacgtgcccgcctccatgctgcctgag
gtgaagccctccagcgaggtttacggctacaccgacacggctctcttcttcggacatgcc
gttcccatcgccggcgccgccggtgaccagcaggccgccctcttcggccaagcttgctac
gcacccggtatggccaagaacacctacggcaccggttgcttcatgctcatgaacaccggt
tcggaactgtacgactccaagaacggtctgctgaccaccattgcttggggtatcgaaggc
aaagtggaatatgcgctggaaggctccatcttcatcgccggcgccgccatccagtggctc
cgcgacggcctgaaactgatcgaagccgctcccgactcggaatacttcgccggcaaagta
gacgacaccgacggcgtctacctggttcccgccttcgccggcctgggcgctccctactgg
gatatgcgcgctcgcggcgccatcgtcggcctgacccgcggcaccaccaaagcccacatc
gtccgcgccgccttggaagccctggcttaccagaccaaggatgtcctcggcgccatggaa
gccgactccaacatcaagctgcaagcgttgaaagtagacggcggcgctgtggccaataac
ctgctcatgcagttccaggcagacatcctcggcgttcctgttgagcgcccccggatcatt
gagacgaccgctctgggcgctgcttacctggccggcctggctgtcggtttctgggagagc
aaagaagagctggccaagcgttggcagcttgacaaccgcttcgaagtcaaaatggccgat
gaaaagcgggccaaactctacggcggctggaaacgggccgtcacccgcagcatggactgg
gaaagggaagactaa

DBGET integrated database retrieval system