KEGG   Heliobacterium modesticaldum: HM1_1596Help
Entry
HM1_1596          CDS       T00653                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HM1_1596 (glpK)
Enzymes [BR:hmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HM1_1596 (glpK)
Exosome [BR:hmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HM1_1596 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611798..1613312
Genome map
AA seq 504 aa AA seqDB search
MSDSMSKKYVMALDQGTTSCRAILFDKDSNIVAVAQKEFTQIYPKAGWVEHNADEIWSTQ
YGVIAELLAKTGISAEEIASIGITNQRETTVVWEKATGKPVYNAIVWQCRRTTAICDELK
ARGLEQTFRTKTGLVVDAYFSGTKVKWILDNVEGAREKAEKGELLFGTMDTWLIWKLTAG
KVHVTDYSNASRTLMYNIRDLKWDEELLAALNVPASMLPEVKPSSEVYGYTDTALFFGHA
VPIAGAAGDQQAALFGQACYAPGMAKNTYGTGCFMLMNTGSELYDSKNGLLTTIAWGIEG
KVEYALEGSIFIAGAAIQWLRDGLKLIEAAPDSEYFAGKVDDTDGVYLVPAFAGLGAPYW
DMRARGAIVGLTRGTTKAHIVRAALEALAYQTKDVLGAMEADSNIKLQALKVDGGAVANN
LLMQFQADILGVPVERPRIIETTALGAAYLAGLAVGFWESKEELAKRWQLDNRFEVKMAD
EKRAKLYGGWKRAVTRSMDWERED
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggattcgatgagcaagaagtacgttatggcgctggaccaaggcaccacaagctgt
cgcgctatcctttttgacaaagacagcaacatcgtcgccgtagcccaaaaggaattcacc
cagatctatcccaaagccggctgggtcgagcacaacgccgatgagatctggagcacccag
tacggtgtcatcgccgaactgctggccaagacgggcatcagtgccgaagagatcgcctcc
atcggcatcaccaaccagcgtgaaacgacggtcgtctgggaaaaagctaccggcaaaccg
gtctacaacgccatcgtctggcaatgtcgccgcaccaccgccatttgcgacgaactgaaa
gcccgcggcctggaacaaaccttccggaccaagaccggccttgtcgtcgacgcctacttc
tccggcaccaaggtcaagtggatcttggacaacgtggaaggcgcgcgggaaaaagccgaa
aaaggcgagctgctcttcggcaccatggacacctggctgatctggaagttgactgccggc
aaggtccatgtcaccgactactctaacgcctcccgcaccctgatgtacaacatccgcgat
ctgaagtgggatgaggaactgctggccgccctgaacgtgcccgcctccatgctgcctgag
gtgaagccctccagcgaggtttacggctacaccgacacggctctcttcttcggacatgcc
gttcccatcgccggcgccgccggtgaccagcaggccgccctcttcggccaagcttgctac
gcacccggtatggccaagaacacctacggcaccggttgcttcatgctcatgaacaccggt
tcggaactgtacgactccaagaacggtctgctgaccaccattgcttggggtatcgaaggc
aaagtggaatatgcgctggaaggctccatcttcatcgccggcgccgccatccagtggctc
cgcgacggcctgaaactgatcgaagccgctcccgactcggaatacttcgccggcaaagta
gacgacaccgacggcgtctacctggttcccgccttcgccggcctgggcgctccctactgg
gatatgcgcgctcgcggcgccatcgtcggcctgacccgcggcaccaccaaagcccacatc
gtccgcgccgccttggaagccctggcttaccagaccaaggatgtcctcggcgccatggaa
gccgactccaacatcaagctgcaagcgttgaaagtagacggcggcgctgtggccaataac
ctgctcatgcagttccaggcagacatcctcggcgttcctgttgagcgcccccggatcatt
gagacgaccgctctgggcgctgcttacctggccggcctggctgtcggtttctgggagagc
aaagaagagctggccaagcgttggcagcttgacaaccgcttcgaagtcaaaatggccgat
gaaaagcgggccaaactctacggcggctggaaacgggccgtcacccgcagcatggactgg
gaaagggaagactaa

DBGET integrated database retrieval system