KEGG   Heliobacterium modesticaldum: HM1_1604Help
Entry
HM1_1604          CDS       T00653                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00010  Glycolysis / Gluconeogenesis
hmo00051  Fructose and mannose metabolism
hmo00562  Inositol phosphate metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
hmo01120  Microbial metabolism in diverse environments
hmo01130  Biosynthesis of antibiotics
hmo01200  Carbon metabolism
hmo01230  Biosynthesis of amino acids
Module
hmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hmo_M00002  Glycolysis, core module involving three-carbon compounds
hmo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HM1_1604 (tpiA)
   00051 Fructose and mannose metabolism
    HM1_1604 (tpiA)
   00562 Inositol phosphate metabolism
    HM1_1604 (tpiA)
Enzymes [BR:hmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HM1_1604 (tpiA)
Exosome [BR:hmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HM1_1604 (tpiA)
  Exosomal proteins of bladder cancer cells
   HM1_1604 (tpiA)
  Exosomal proteins of melanoma cells
   HM1_1604 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABZ84174
UniProt: B0TDD3
Position
1622249..1623001
Genome map
AA seq 250 aa AA seqDB search
MRRPIIAGNWKMHKTIAEAVQLAEALKRQQGEPQAEIVLCPPFTALAAVAAVIQDSPIAL
GAQNMHWEEQGAFTGEISPNMLKDVGCAYVILGHSERRQYFGETDELVNGKVKAALTHAL
TPIVCVGETLAQREAGETEAIVATQTRGALAGLAPEAVASLVIAYEPVWAIGTGKTASDD
DAQQVIAFIRATVAAEFGNAAAEAVRIQYGGSVKAANAASLLSRPDIDGALVGGASLKAA
DFQGIIDGVR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacccatcattgccggcaactggaagatgcacaagaccattgcggaggccgtt
caactggccgaggccttgaaaaggcagcagggagaaccgcaggcggagatcgtcctctgc
ccgccctttacggccctggccgccgtggcagccgtcatccaagacagccccatcgccttg
ggcgcccagaacatgcactgggaagagcagggcgccttcaccggcgagatctcaccgaat
atgctcaaagacgtcggctgcgcctatgtgatcctcggccattcggagcggcgccagtac
ttcggtgaaacggacgaactcgtcaacggcaaagtgaaagccgctctcacccatgccttg
acgcccatcgtctgcgtcggcgagaccctggcccagcgggaagcgggggagacggaggcc
atcgtcgccacccagacccgcggcgccttggccggactcgcgcctgaggccgtcgcctcc
ctggtcatcgcctacgagcctgtctgggccatcggcaccggcaaaaccgcctctgacgac
gacgcccagcaggtcatcgccttcatccgcgccaccgtggccgccgaattcggcaacgcg
gcggcagaggcggtccgcatccaatacggcggcagcgtgaaagcggccaatgcggcgagc
ctcctctcccgccccgacattgacggcgccctcgtcggaggcgccagtttgaaagcggca
gattttcaagggatcatcgacggcgtccgctag

DBGET integrated database retrieval system