KEGG   Heliobacterium modesticaldum: HM1_1604Help
Entry
HM1_1604          CDS       T00653                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HM1_1604 (tpiA)
   01230 Biosynthesis of amino acids
    HM1_1604 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HM1_1604 (tpiA)
   00051 Fructose and mannose metabolism
    HM1_1604 (tpiA)
   00562 Inositol phosphate metabolism
    HM1_1604 (tpiA)
Enzymes [BR:hmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HM1_1604 (tpiA)
Exosome [BR:hmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HM1_1604 (tpiA)
  Exosomal proteins of bladder cancer cells
   HM1_1604 (tpiA)
  Exosomal proteins of melanoma cells
   HM1_1604 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1622249..1623001
Genome map
AA seq 250 aa AA seqDB search
MRRPIIAGNWKMHKTIAEAVQLAEALKRQQGEPQAEIVLCPPFTALAAVAAVIQDSPIAL
GAQNMHWEEQGAFTGEISPNMLKDVGCAYVILGHSERRQYFGETDELVNGKVKAALTHAL
TPIVCVGETLAQREAGETEAIVATQTRGALAGLAPEAVASLVIAYEPVWAIGTGKTASDD
DAQQVIAFIRATVAAEFGNAAAEAVRIQYGGSVKAANAASLLSRPDIDGALVGGASLKAA
DFQGIIDGVR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacccatcattgccggcaactggaagatgcacaagaccattgcggaggccgtt
caactggccgaggccttgaaaaggcagcagggagaaccgcaggcggagatcgtcctctgc
ccgccctttacggccctggccgccgtggcagccgtcatccaagacagccccatcgccttg
ggcgcccagaacatgcactgggaagagcagggcgccttcaccggcgagatctcaccgaat
atgctcaaagacgtcggctgcgcctatgtgatcctcggccattcggagcggcgccagtac
ttcggtgaaacggacgaactcgtcaacggcaaagtgaaagccgctctcacccatgccttg
acgcccatcgtctgcgtcggcgagaccctggcccagcgggaagcgggggagacggaggcc
atcgtcgccacccagacccgcggcgccttggccggactcgcgcctgaggccgtcgcctcc
ctggtcatcgcctacgagcctgtctgggccatcggcaccggcaaaaccgcctctgacgac
gacgcccagcaggtcatcgccttcatccgcgccaccgtggccgccgaattcggcaacgcg
gcggcagaggcggtccgcatccaatacggcggcagcgtgaaagcggccaatgcggcgagc
ctcctctcccgccccgacattgacggcgccctcgtcggaggcgccagtttgaaagcggca
gattttcaagggatcatcgacggcgtccgctag

DBGET integrated database retrieval system