KEGG   Heliobacterium modesticaldum: HM1_1725Help
Entry
HM1_1725          CDS       T00653                                 

Gene name
araD
Definition
l-ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HM1_1725 (araD)
Enzymes [BR:hmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HM1_1725 (araD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1730422..1731066
Genome map
AA seq 214 aa AA seqDB search
MENLRHQILHYGRLMIERGLVSGTGGNISCRLPEGDQMLVTPSQMAYDQLTPEDLVIVDI
LSGDVLEGARRPSIEQGLHRAIYRARPDVKAIIHTHSRHATAVASTRKDIPPFLDNMVVN
FGGGVRTAAHAPIGTPELAEYTVRALGDAPVALLANHGGVAVGKDLAQAFSLAEFLEECA
MVYLLSFLAGGPVTLAPEVVERERAWLQGRYGQR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacctccgccaccagatactgcattatggccggctgatgatcgagcgcggtctc
gtctccggaacaggcgggaatatcagttgccgtttgccggagggggaccagatgctggtc
acacccagccagatggcctacgatcagttgacaccagaggatctggtcattgtggacatc
ctcagcggggacgtgctggaaggcgcgcgacgcccgtccattgaacagggactgcaccgc
gcgatctaccgagcccgtcccgatgtcaaggcgatcatccatacccactccagacatgct
actgcagtcgcatccacgcgtaaggacatcccgccttttctggataacatggtcgtcaac
ttcggcggcggcgtcagaacggcggcgcatgcccccatcggcacgcctgagctggccgaa
tatacggtgcgcgccctgggcgatgcgccggtcgccttgttggccaaccatgggggggtc
gccgttgggaaggatctggctcaggccttctccctcgcagagtttttggaggagtgcgcc
atggtctatcttctctccttcctggccggcggtcccgtcacgcttgcgccggaggtggtc
gagcgggaacgagcctggctgcaagggcgttacggccaaaggtaa

DBGET integrated database retrieval system