KEGG   Heliobacterium modesticaldum: HM1_1749Help
Entry
HM1_1749          CDS       T00653                                 

Gene name
mutM
Definition
formamidopyrimidine-dna glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hmo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1755004..1755837
Genome map
AA seq 277 aa AA seqDB search
MPELPEVETVRRSLAGRITGLTIEKVELRLPKIAFALPGTLFTDALRGRRIIELGRRGKY
LLLHLDGDETLVIHLRMTGRLIHLRPEEREEPEAAHTHAVFFLDDGSLLRYTDVRQFGTL
TLMTREAALRQPGKGRLGPEPLGQDFSFVDFRNALVKRKTKLKPLLLDQSFLAGLGNIYA
DEALARARLHPDRTADSLDDEESRRLYDCIRTVLQEGIDAKGTSFRDYVDGEGRKGEFQE
KLWVYGRGGNPCRRCGGEILREKRAGRSTHFCPRCQK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgccggaagtggaaactgttcgccgcagcctggccggccgcatcaccggg
ctgaccatcgaaaaggtcgagctgcgcctgccgaagattgccttcgccttgccgggcacc
cttttcaccgacgcccttcgggggcggcggatcatcgaactggggcggcggggaaagtac
ctgttgcttcacctcgacggcgatgagacccttgtcattcatttgcgcatgaccggtcgg
ctcatccatcttcggcctgaggaacgggaagaaccggaagcggcccacacccacgctgtc
ttctttctcgatgacggcagcctgcttcgctacaccgatgtgcgccagttcggcacgctg
acgctgatgacgagggaagcggccttgcggcaaccggggaagggccgtctcggccccgaa
ccgctgggacaggacttctccttcgtcgatttccgcaacgccctagtcaagcggaagacc
aaactgaaaccgctgttgctcgatcagtccttcctggcggggctggggaacatctatgcc
gatgaggctctcgcccgggccaggctccaccccgaccggacggccgactcccttgacgat
gaggaaagccgccggctctatgactgcatccggactgtccttcaggagggcatcgacgcc
aagggaacatccttccgcgattatgtcgacggcgaagggcgcaagggcgagtttcaggaa
aagctgtgggtctacggacggggaggcaacccctgccgccgttgcggcggcgagatcctt
cgggaaaagcgtgccgggcggagcacccatttttgcccgcgctgtcaaaaataa

DBGET integrated database retrieval system