KEGG   Heliobacterium modesticaldum: HM1_1921Help
Entry
HM1_1921          CDS       T00653                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HM1_1921 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HM1_1921 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HM1_1921 (trpB)
Enzymes [BR:hmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HM1_1921 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1920996..1922213
Genome map
AA seq 405 aa AA seqDB search
MILHNKKEVSALIGQLPPDGRFGAFGGAFVPETLKPALEELEAAFRQMTDDAVFREELQT
LLAEYAGRPSRLYFARRLTEHLGGARLYLKREDLNHTGSHKINNTLGQVLMAKRMGKKRV
IAETGAGQHGVATATACALFGIPCEVYMGAEDVERQALNVLRMQLLGAKVIAVTSGTRTL
KDAINEAMRDWVANVQDTFYCFGTAAGPHPYPSIVRYFQSVIGIEARAQILDKEGRLPDA
VLACVGGGSNAMGMFSGFLDDASVRLIGVEAGGDGVKTGRHSASLTAGLPGVLHGAVSYL
LQDDDGQIMGTHSIAAGLDYPGVGPQLSYLKDSGRAEFVAITDKEALEGVRILALTEGIL
PALESAHAIAQAAKMAPQMSPDSLLIVNLSGRGDKDVHTLAGEVG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgattttgcacaataagaaagaggtgtccgccttgattggacagcttcccccagatggt
cgttttggcgctttcggcggcgcctttgtccccgagacgctgaagccggcccttgaggaa
ctggaggccgcattccggcagatgaccgacgatgctgtctttcgggaggagttgcagacg
ctcctcgccgaatacgccggccggcccagccgcctctactttgcccggcggcttacggaa
cacctgggcggcgcccgcctctacctgaagcgggaggatctgaaccataccggttcccat
aagatcaacaacaccctcggacaggtgctgatggccaagcggatgggcaaaaaacgggtc
attgccgagacgggcgccggacagcacggcgtggccacggcgacggcctgcgccctcttc
ggcatcccttgtgaggtctatatgggcgcggaagacgtagagcgccaggcgttgaacgtg
ctgcgcatgcaactgttgggagcgaaggtgatcgccgtcacctcgggcacgcggacgctc
aaagacgccatcaacgaggccatgcgcgactgggtggccaatgtgcaggacaccttttac
tgcttcggcaccgccgccggccctcatccctatccttcgattgtgcggtacttccagtcg
gtcatcggcatcgaggcgcgcgcccagatcctggacaaggaaggccgccttcccgacgcc
gtgctggcctgtgtcggcggcggcagcaacgccatgggcatgttttccggcttcctggac
gatgcgtcggtccgcctgatcggcgtcgaggccggcggtgacggggtgaagacggggcgg
cactcggcgtcgctcacggccggcctccccggtgtgctgcatggcgccgtctcctacctg
ttgcaggacgacgacgggcagatcatggggacccattccatcgccgctggtcttgactac
cccggtgtgggaccccaactctcttacttaaaagacagcggcagagccgagtttgtggcg
atcaccgataaagaagccctggagggcgtccgcatcctggccctgacggagggcatcctg
ccggccctggaaagcgcccacgccatcgcccaggcggcgaaaatggcgccccagatgagc
ccggacagcctgttgatcgtcaacctgtcgggccgcggcgacaaagacgtgcacacactg
gccggggaggtgggctga

DBGET integrated database retrieval system