KEGG   Heliobacterium modesticaldum: HM1_1937Help
Entry
HM1_1937          CDS       T00653                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HM1_1937 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HM1_1937 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HM1_1937 (thrC)
Enzymes [BR:hmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HM1_1937 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1938052..1939101
Genome map
AA seq 349 aa AA seqDB search
MNRQGIIPTFKDFLPVTEKTPMVSLCEGNTPLIAAPRLSQQIGAELYFKYEGLNPTGSFK
DRGMVMAVAKAVEEGAQAIMCASTGNTSAAAAAYAARCGIKCIVIIPEGKIALGKLAQAL
IYGAKVIAIEGNFDEALKIVRDICAKHPITLVNSVNPYRIEGQKTAAFEVCQQLGDAPDY
LAIPVGNAGNITAYWKGFVEWKQAGKVDKTPKMIGFEAEGAAAIVFDRVIEKPETVATAI
RIGNPASWQGAVAAARDSGGFIDYVTDEEILEAYRLLASQEGIFCEPASAASLAGVIKKR
QAGILPEGAKIVCVLTGHGLKDPDNAIKTVSGGPIMVPATEEAVLREVF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaataggcagggcatcatccccacattcaaagactttctgccggtgaccgaaaagacg
cccatggtgtcgctctgcgagggtaacacgcccctcatcgccgcgcctcggctttcccaa
caaatcggcgccgaactttatttcaaatatgaagggctcaacccgaccggttccttcaag
gatcgaggcatggtcatggccgtcgccaaggccgtcgaagagggcgcccaggcgatcatg
tgcgcctcgacgggcaacacctccgctgctgccgccgcctatgccgcccgctgcggcatc
aagtgcatcgtcatcatccccgaaggcaagatcgccctcggcaaactggcccaggcgctg
atctacggcgccaaggtcatcgccatcgagggcaactttgacgaagccctgaagatcgtc
cgcgacatctgcgccaaacaccccatcaccctggtcaactcggtcaatccctaccggatc
gaagggcagaagacggctgccttcgaggtctgccagcaactgggcgatgcgcccgactac
ctggccatccctgtcggcaacgccggcaacatcaccgcctactggaaaggctttgtcgag
tggaagcaggccggcaaggtggacaagacccccaagatgatcggctttgaggcggaaggc
gccgccgccatcgtctttgaccgtgtcattgagaaaccggagacggtggccacggccatc
cgcatcggtaaccccgcttcctggcagggcgctgtcgcggcagcccgcgactccggcggc
tttatcgactatgtgaccgacgaggagatcctcgaggcctatcgcctgctcgcctctcag
gaaggcatcttctgcgaaccggcatcagctgcttccctggccggcgtgatcaaaaagcgt
caagccggcatcctgcccgaaggcgccaagatcgtctgcgttctcaccggccacggcttg
aaagaccctgacaatgcgatcaaaacggtgtccggcggcccgatcatggtgccggccaca
gaagaggctgttctgcgggaggttttttaa

DBGET integrated database retrieval system