KEGG   Heliobacterium modesticaldum: HM1_1966Help
Entry
HM1_1966          CDS       T00653                                 

Gene name
cobA
Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hmo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1964902..1966446
Genome map
AA seq 514 aa AA seqDB search
MKQKVGKVYLVGAGPGDPGLITVKGLECIKKAEVLVYDRLAGHRLLTYARPDAELIFVGK
GPDKHVYRQEEINEVLKVKGLEGKIVTRLKGGDPFVFGRGGEEAEVLREAGVPFEIVPGI
TSAISVPAYAGIPVTHRDFTSNFAVITGNEDPTKEDSAIDWAKISTGIGTLVFLMGMGNL
PHIAAKLMEHGRSPETPVGLIRWGTRPEQRTLTGTLADIAQKAKEAAFQNPAIIIVGEVV
KLREKLAWLEEKPLFGKRIVVTRSRQQASAFAARLEEMGGEPWEFPTIDIQEPEDPAPLE
EAIAKVHEYEWIIFTSPNGVQRFFERFFAVGHDIRELCGIRLCAIGPQTRKELQKFGLKT
DFVPEEYRAEAIIEGLKNLDDWQGRKVLLPRADIARKILPEALASFGAQVDDVVAYRTVR
GGGDAVLLRQMLQDKLIHAITFTSSSTARNFVDMLGVEDVAERNALLEGVTMASIGPITS
DTMRELGLPVDVEATEYTIPGLMKALLSHWGIHE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaggtagggaaggtttatctggtcggcgccggaccgggggatccgggcctc
atcaccgtgaaagggttggagtgcatcaaaaaagccgaggtgcttgtgtacgatcgcctg
gctggtcaccggttgctcacctatgcgcggcctgacgccgagctgatctttgtcggcaaa
gggccggataagcatgtctatagacaggaagagatcaacgaggtcctcaaggtcaaaggc
ctggaaggtaagatcgtcacccgtctgaaaggcggcgatcccttcgtcttcggtcgcggc
ggcgaagaagcggaggtgctccgcgaagccggcgtcccctttgaaatcgtccccggcatc
acctcggccatctccgtaccggcctatgccggcatccccgtcacccaccgcgatttcacc
tccaatttcgccgtcatcaccggcaacgaagaccctaccaaggaagactcggctatcgat
tgggccaaaatcagcaccggcatcggcaccctcgtcttcctgatgggcatgggcaatctg
ccccatatcgccgcgaagctcatggaacacggccgcagcccggaaacgccggtaggcctg
atccgctggggcacgcggccggaacagcgcaccctgacgggcaccctggctgatattgcc
cagaaggcgaaagaagccgccttccagaacccggccatcatcatcgtcggcgaagtagtc
aagctgcgcgagaaactggcctggctggaagagaaaccgctcttcggtaagcgcatcgtt
gtcacccgctcccgccagcaggcgtcggctttcgctgcccgcctggaagaaatgggtggc
gagccctgggagttccccactatcgatatccaagaaccggaggatcctgcgccgctggaa
gaagccatcgccaaggttcatgaatatgagtggatcattttcacatcccccaacggtgta
cagcggttctttgagcgcttcttcgccgtcggtcacgacatccgcgagctctgcggcatc
cgcctctgcgccatcggtccccaaacccgcaaggaactgcagaagttcggcctgaagacc
gacttcgtgccggaagaataccgcgccgaggccatcatcgaagggttgaaaaacctcgat
gattggcagggccgcaaggtgctgctacctcgggccgacattgcccgcaagatcctccct
gaagcgctggcctcctttggcgcccaggtggacgacgtggtcgcctaccggactgtccgc
ggcggcggcgacgctgttctcctccgccagatgttgcaagacaagctgatccacgccatc
accttcaccagttcctctacggctcgcaattttgtcgacatgctcggcgtagaagatgtg
gctgagcgcaatgcgctgctcgaaggcgtgaccatggcctccatcggccctatcacctcc
gatacgatgcgagaactgggcttgcctgtggacgtggaggccaccgaatacaccattccc
ggtctgatgaaggcgttgctgtcccactggggcatccacgagtga

DBGET integrated database retrieval system