KEGG   Heliobacterium modesticaldum: HM1_2027Help
Entry
HM1_2027          CDS       T00653                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase, cheb
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:hmo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:hmo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2027030..2028061
Genome map
AA seq 343 aa AA seqDB search
MKKIRVVLVDDSPVALFVLKKILSRAEHIEVAATATDGRQALSLIPMVDPDVVCTDLHMP
EMDGLELTRRLMEAFPKPIMVMSAVDGNAERTFQVLQAGALEFVDKPAGLAEKELNDKAK
EIIDKISVLAGVKVFRRRNRQSQLPSLAGQGQPITVPAVIGIGASTGGPTAFAEILREVI
SVPVPIVAVQHMAAGFMNAFVHHLNGFSRIEAKLAENGEKMRPGRIYFAPEDYHLEVERG
GCLRLTRAAPLEGHRPSVGVLLDSLARQYGADSWGILLTGMGKDGAAALKAIRDAGGYTI
AQDEASCVVYGMPGEAEKIGAACRFMTPRRIGQLLACLGTDNR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatccgcgtggtccttgtagatgattcgccggtggcgctctttgtactgaag
aagattctctcccgggctgagcatatcgaggtggcagcaacggcaacagacgggcgccaa
gccttgtccttgatccccatggtggatccagatgtggtctgcaccgatttgcacatgcct
gagatggatggtctcgaattgacgcgccggctgatggaggcgtttccgaagccgatcatg
gtcatgagcgctgttgacggcaatgctgagcggacctttcaggtcctccaggcaggggcg
cttgaatttgtcgacaaaccggccggactggccgaaaaggagctgaacgacaaggcgaag
gagatcatcgacaagatcagcgtcctggccggggtcaaggtctttcgccggcgtaaccgg
cagtcccaactgccatcacttgcgggacaagggcagccgatcaccgtccctgccgtgatc
ggcatcggcgcctcaacaggcggaccgacggcctttgcggagatcctgcgcgaagtcata
tcagtgcctgtgcccatcgtggctgtccagcacatggctgccggcttcatgaacgccttc
gttcatcacctgaacggattttctcggatcgaggccaagctggcggagaacggcgagaag
atgcgccccggccggatctatttcgctcccgaagattatcatctcgaggttgaacgaggc
ggttgcctgcgcttgactcgcgctgccccgctggagggccaccgaccgtcggtcggcgtc
ctgttagactcccttgcgcgccagtacggcgctgacagctggggcatcctgttgacaggt
atgggcaaagacggtgccgccgctctcaaggccatccgcgacgccggcggctacaccatc
gcccaagacgaagccagttgcgtcgtctatggcatgcccggcgaggcggaaaaaatcggc
gctgcctgccggttcatgacaccgcggcggatcgggcaactgctggcctgtttggggacg
gataatcgataa

DBGET integrated database retrieval system