KEGG   Heliobacterium modesticaldum: HM1_2127Help
Entry
HM1_2127          CDS       T00653                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hmo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2131185..2131766
Genome map
AA seq 193 aa AA seqDB search
MGRGVLLVMSGPSGAGKGTLSRRLLNELPQLTLSISATTRKPREGEREGVHYYFLRKEDF
ERQIGENRFLEFAQVYDNYYGTPLAPVQAALASGKDVLLEIDIQGALQVKERYPEAALIF
IAPPSLEELARRIYGRGTDSQEVIEKRLSLASQELEFINRYDYCVINDDVDRALTRLRAI
VEAEKSRIYRKLE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcggcgtcctgctggtcatgtccggcccttcgggggcgggcaaggggaccctc
agccgccgcctcttgaacgaactgccgcaactgaccttatccatatctgccacgacccgc
aagccccgcgagggcgagcgggagggggttcattattattttctgcgcaaagaggacttt
gaacggcagatcggggaaaaccgttttctcgagttcgcccaagtctacgataactactac
gggacacccttggcaccggtgcaggcagcgctggcttccgggaaggatgtccttttagag
atcgatatccagggggcgctgcaggtcaaggagcgctaccccgaagcggcgctgatcttt
atcgcgcctccctcgctggaagagctggcccggcggatctacggccgaggcaccgacagc
caggaggtcattgaaaaacggttaagcctggcttcgcaggagttggagttcatcaaccgc
tacgactactgcgtcatcaacgacgacgtggaccgggcgctcacccgcctgcgggcgatt
gtggaggccgagaagtcgcgcatctaccgtaagctggaataa

DBGET integrated database retrieval system