KEGG   Heliobacterium modesticaldum: HM1_2246Help
Entry
HM1_2246          CDS       T00653                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase, cheb
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HM1_2246 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    HM1_2246 (cheB)
Enzymes [BR:hmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     HM1_2246 (cheB)
Two-component system [BR:hmo02022]
 CheA family
  CheA-CheYBV
   HM1_2246 (cheB)
Bacterial motility proteins [BR:hmo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HM1_2246 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2240208..2241350
Genome map
AA seq 380 aa AA seqDB search
MPQIKVLVVDDSAFMRKVISDMIAAEPGMVVVGTARNGQDALEKIGQLSPDVLTLDVEMP
VMDGLTTLERIMASRPMPVVMLSSLTQQGADATMQALQKGAVDFVPKPSGAISLDIHKVR
QELISKLKVAAIAKVRSRAVDFRTLKPPLSPPSAATIPSVLPAPVQVSAPVARAKTPPAI
GSQRLNKLVLIGTSTGGPKALYEVIPKLPADLGAAVLIVQHMPPGFTRSLAERLDAASVL
KVKEAQDGEEIQPGVVYIAPGDYHFKVTMAEQPGAGRTLRVKLTQEPPVGGHRPAVDVMM
LSVAQQFWSHMVGVILTGMGGDGTEGMKMIKSRQGRTIAEDASTCVVFGMPKVAIESGCV
DKVVPLTGVADEIVKSLQDR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagatcaaagtgttggttgtcgacgattccgcatttatgcgcaaagtgatatcg
gatatgattgctgccgaaccgggtatggtcgtcgtgggaactgcgcgcaacgggcaggat
gccttagaaaagatcggccaattgtctcctgatgtgcttaccctggatgtggaaatgcct
gtcatggatggcctaaccaccttggaacgcatcatggcctcccgaccgatgccggtcgtc
atgctgtccagtttgacccagcagggcgctgacgccactatgcaggcgttacaaaaaggg
gctgtcgattttgtcccgaaaccatcgggcgccatctccctcgatatccacaaggtccgc
caggaattgatcagcaaattaaaagtagcagccatcgctaaagttcgaagtcgggcagtt
gatttccgaacgctgaagccaccgctttctccaccgtcggcagcgacaatcccatcggtt
ctacccgcgccggttcaggtttcagcgccggtcgctcgggccaaaacgcctccggcgata
ggctcacagcggctgaataaactggtgttgatcggcacgtctacaggcggtccaaaggcg
ctctatgaggtcattcccaaactccctgccgatctcggcgcggctgtccttatcgtacag
cacatgcctcccggcttcacccgctcgctggcggagcgtctcgatgccgcatcggtcctg
aaggtgaaagaggctcaagacggcgaagagattcaaccgggtgtcgtctatatcgcgccg
ggcgactatcatttcaaggtgaccatggcggaacagccaggcgctggacggacactccgg
gtgaaattgactcaggaaccgcccgtaggcggacatagaccggctgtggatgtgatgatg
ctctccgttgcccagcaattctggtctcatatggtgggagtaattttgaccgggatgggt
ggagatgggacggaaggaatgaagatgatcaagagtcgtcagggacgtacgattgcggag
gatgcctcgacttgtgtggttttcgggatgccgaaagtggccatcgaatcaggctgtgtt
gacaaggtagtccccctaaccggcgtcgccgatgagatagtaaaatcattgcaggacaga
tag

DBGET integrated database retrieval system