KEGG   Heliobacterium modesticaldum: HM1_2416Help
Entry
HM1_2416          CDS       T00653                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HM1_2416 (rbsK)
Enzymes [BR:hmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HM1_2416 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2405890..2406813
Genome map
AA seq 307 aa AA seqDB search
MTKPRLLVIGSINVDLVAYAERIPHTGETVKGKQFSTIPGGKGANQAMAANRLGAEVTFL
GAVGDDGYGKDMLRYFRENGLDPSRVKQVPGSTGVAMIVVDDAGNNQIVVVPGANDQLKP
ADLEACADDFSAADVVVIQLETPLETVGKAIELAAFVKKPLILNPAPAQKLPEDWLRSVT
YLVPNEHEAALLGGDPGRNFADLQEKMTGTLIVTMGEKGVLFNASGLNDSGDSNLRRIPA
FSVPVVDTTAAGDAFVAGFAVALAEGQPLEEALRFASAVAALSVTKAGAQTSLPLREEVN
RFLEGLT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagccgcgtctgctcgtcatcggcagcatcaacgtagatcttgtggcctatgct
gagcggattcctcatactggggagacagtcaagggaaaacagttttccaccatcccaggc
ggcaagggcgctaaccaggccatggcggccaaccgtctcggcgctgaggtaacttttttg
ggcgctgtcggcgatgatggttacggaaaggatatgctgcgatatttccgcgaaaatggg
ttggacccctcgcgggtaaagcaggttcccggttccaccggtgtagccatgatcgtcgtt
gacgacgccgggaataaccagatcgtcgtcgtccccggcgccaacgatcaactgaaacca
gccgatctggaggcctgcgccgacgatttctctgccgccgacgtagtggtgatccaactg
gaaacgcccttggagacagtggggaaagcgattgagctggctgcttttgtgaaaaaacct
ttaatcctcaaccctgcaccggcgcaaaaactgcctgaagattggcttcgcagcgttacc
taccttgtgccgaatgagcacgaagcggccctgctcggcggcgatccagggcgcaacttc
gctgacttgcaggagaaaatgacgggaacgctgatcgtgacaatgggcgaaaagggtgtc
ttattcaatgccagcggccttaacgatagcggcgatagcaacctgcgccgcatccctgcc
ttctctgtccctgtcgtcgacacgacggccgccggcgacgccttcgtcgccggatttgct
gtcgcactggccgaagggcaaccgctggaggaagccctccgcttcgccagcgccgtcgct
gccttgtcggtgacgaaggcgggcgcccagacatcgctgccgctcagggaagaagtcaat
cgttttttggagggtcttacatga

DBGET integrated database retrieval system