KEGG   Heliobacterium modesticaldum: HM1_2697Help
Entry
HM1_2697          CDS       T00653                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00260  Glycine, serine and threonine metabolism
hmo00750  Vitamin B6 metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
hmo01120  Microbial metabolism in diverse environments
hmo01230  Biosynthesis of amino acids
Module
hmo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HM1_2697 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HM1_2697 (thrC)
Enzymes [BR:hmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HM1_2697 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zinc_ribbon_2 zf-Mss51
Motif
Other DBs
NCBI-ProteinID: ABZ85226
UniProt: B0TBV3
Position
complement(2667307..2668548)
Genome map
AA seq 413 aa AA seqDB search
MRHVLALQCIHCGKQHDPGDVDYYCPLCGYHEGILDVLYDYEAVKAEMDPVTFSAGGPRS
MWRYLPLLPVAEPERISHLQVGWTPLYRASRLAETLDVADCWVKDEGRNPTASFKDRASA
VGVLKAMERGASRITCASTGNAASSLAGFAAAAGLPASIFVPKRAPEAKVAQLLVFGAQV
FSVQGTYDQAWELCMAASSHFGWYNRNCAINAYLIEGKKTVALELVEQFRERGAFPDWVV
VSVGDGCTIGGVWKGFKEMQRIGWIEKTPKILGVQAAGCQPFVTAWREGKRLTPCEADTL
ADSIAVGHPRNFVKGLRAVTESGGAYVAVPDQAILEAMTTLARKAAVFGEPAGATGVAGV
QEARRQGIIGPDDVVAVIVTGNGLKDIASAIRAAGLPVPVDPALDAVRRVASP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgtgctagcactgcagtgtatccattgcgggaaacagcatgatcccggcgat
gtggactattactgtcccctctgcggctaccatgagggcatcctcgacgtgctctatgac
tatgaggcggtcaaggcggagatggaccctgtcaccttcagcgcgggcggaccgcgctcc
atgtggcggtacctgccgctcctgccggtcgccgaaccggagcggatcagccatctgcag
gtcggctggacgcctctctatcgagcctcgaggctggcagaaacgctcgatgtggccgac
tgctgggtgaaagatgaaggccgcaacccgacggcctctttcaaggaccgggccagcgcc
gtaggggttctcaaggccatggagagaggcgcctcccggatcacctgtgcctccacgggc
aacgcggcctcctccttagcgggctttgccgccgccgccggtctgccggcctccatcttc
gttcctaagcgggcgccggaagccaaggtggcccagttgctcgtcttcggcgcccaggtg
ttttccgttcaaggaacctatgatcaagcctgggaactgtgcatggcggccagcagccac
ttcggctggtacaaccgcaactgcgccatcaacgcttacctaattgaagggaagaaaacg
gtcgccctggaactcgttgagcagttccgggagcggggcgccttccccgactgggtcgtc
gtctctgtcggcgacggctgcactatcggcggcgtctggaaaggcttcaaggagatgcag
cgcatcggctggatcgaaaagacgccgaagatcctgggtgtgcaggccgccggttgccag
cccttcgtcaccgcctggcgggaggggaaaaggctcaccccttgtgaggccgataccttg
gctgattccatcgccgtcggtcacccccgcaattttgtcaaagggctgcgagccgtgaca
gaatcgggcggggcttatgtcgccgtacccgaccaggccatcctcgaagccatgaccacc
ctggcccgcaaggccgccgtctttggcgaaccggccggcgccaccggtgtggccggcgtc
caggaggctcgccgtcaagggatcatcggccctgacgatgtggtggctgtcatcgtcacg
ggaaatggcttgaaggacatcgccagcgccatccgggcggccgggctgcccgtgccggtc
gatccagcgttggatgctgtccggcgcgtagcgagcccctga

DBGET integrated database retrieval system