KEGG   Heliobacterium modesticaldum: HM1_2777Help
Entry
HM1_2777          CDS       T00653                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HM1_2777
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HM1_2777
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HM1_2777
Enzymes [BR:hmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     HM1_2777
Exosome [BR:hmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HM1_2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2744639..2746327)
Genome map
AA seq 562 aa AA seqDB search
MNKATKNMIAAVIGTAMLLTSLSPALAAGASTSQGKAKNVIFMLSDGNSIGGTTLTRWYN
IAKSKDPQFRLAIDDPAFTLALQRTFGANSIITDSAPAGTAYSTGFKSDSGYISVLPDKI
NIPGAKEYSGSEPFKPVATVLEGAKLMGKATGIVSTSQIQHASPAATSAHWYKRSNYEEI
AKQQVYQDIDVVLGGGAGYLGQKRADGQDLIKVIKQRGYDYVTDTGKLKASKAEKIWGMF
ADVSLDRDIDRNPAQQPSLAEMTQAAIERLSKDKDGFFLFVEGSEVDWSAHANDPVGLIS
EINAFDRAVKVALDFAKKDKNTLLIVTTDHGNGGITIGNSLSDESYDTMPLETVMAPLLK
VNRTSDSIVRELPKDATDEQIKEAIAKYYSITDMTDEELAEAKKWLAKDSDRDYGIGRIL
SKRARIGWTTHGHTGEDVLVFSYGPHSLSGLLDNTDAARVMAKAMGFDLADVNRKLMVNA
KEAFAKLGAKCNIDATDAKNPVVVVEKDNVKAKLPISTDIIIINDKADTMTGLTVRGKED
ASVYVPQEAVDRFAAALKASKK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggcgacaaaaaacatgatcgccgccgtcatcgggacggccatgctgttgaca
tccctatcccccgcccttgccgccggcgcctcgaccagtcaaggcaaagcgaagaacgtc
atcttcatgctgagtgacggcaactcgatcggcggtacgaccctgacccgctggtacaac
atcgccaaaagcaaggacccgcaatttcgtcttgctatcgatgatcccgcctttacactg
gccttgcagcgcacctttggcgccaactcgatcatcaccgactcagcgcctgccggaacc
gcttactcgacgggattcaagagcgacagcggatacatatcagtccttcccgacaagatc
aacattcccggcgccaaggaatacagcggcagcgagcccttcaagcctgtcgccactgtc
ttggagggggccaagctgatgggcaaggccaccggcattgtctctacctcccagatccag
catgcatctccggcggccacatcggcccactggtataagcgttccaattacgaggagatc
gccaaacagcaggtctaccaggacatagacgtcgtcctcggcggcggcgccggctacctt
gggcaaaagcgcgccgacggccaggacctgatcaaggtgatcaagcaacgcggctacgac
tatgtgaccgacaccggcaagttgaaggcctctaaggcggaaaagatctggggcatgttc
gccgatgtctccctggatcgcgacatcgaccgcaacccggcgcaacaaccgagcctggct
gagatgacccaagcagccatcgagaggctcagcaaagacaaagatggcttctttctcttc
gttgaaggcagcgaagtggactggtctgcccacgccaacgaccctgtcggcctgatcagc
gaaatcaacgcctttgaccgcgccgtcaaagtggccctcgattttgcgaaaaaggacaag
aacaccctgctgatcgtcaccaccgaccacggcaatggtggcatcaccatcggcaacagc
ctctccgacgaatcctacgatacaatgcccctcgagacggtgatggcgccgttgctcaag
gtgaaccgtacctccgattccatcgtccgtgaactgccgaaagacgccacagacgaacag
atcaaagaagccatcgccaagtattacagcatcaccgatatgactgacgaggaacttgca
gaggcgaaaaaatggctagccaaagacagtgatcgcgactacggcatcggcaggattttg
agcaagcgcgcccgcatcggctggaccacccacggccataccggcgaggatgtcctcgta
ttcagttacggtccccacagtctctcgggactgctggacaacaccgatgctgcccgcgtg
atggccaaagcgatgggctttgatctcgccgatgtaaacaggaagttgatggttaacgcc
aaagaggcctttgccaaactgggtgccaagtgcaacatcgacgccaccgacgccaaaaac
cctgttgttgtcgttgaaaaggacaacgtcaaagccaagctgcccatcagcaccgacatc
atcatcatcaacgataaggcggacaccatgaccggtctgactgtccgcggcaaagaagac
gcctccgtttacgtgccccaggaggccgtcgaccggtttgcggcggctctgaaggcgtcc
aagaaatag

DBGET integrated database retrieval system