KEGG   Heliobacterium modesticaldum: HM1_3003Help
Entry
HM1_3003          CDS       T00653                                 

Definition
type iii restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hmo  Heliobacterium modesticaldum
Brite
Enzymes [BR:hmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HM1_3003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2955172..2958240)
Genome map
AA seq 1022 aa AA seqDB search
MMTNRIAFQFDDKLGYQKDAVNSVVNLFKGVSRHDDGTIYRQLQRMKKLVEGDPVRNPQL
VSPARLLHNLREVQQKNKLFTDHELKGNNFTIEMETGTGKTYVYLRTILELYRAYGFTKF
MIVVPTIAIRKGVEKTMAMLREHFKGIYDGLDIMNHAFVYDSKNLKKISSSFVETRDLSI
VVMNIQAFNKDSNKIRQSDEYGQILWEDIRYIHPIVIIDEPQKIEGTAKKKSASLEAIEG
IDPLFVLRYSATHKSRYNQVYKLDSFDAYQKDLVKKIQVKTVHGAIPKDFPYVRYVEFTK
DLFAKIELFCVEQGGQIRKKQVKVRGGDSLFECSGNLDQYKNMFVMEDPHKLKKLKISKW
DDILELAVGENNADISEEETIRIQIRLAIKSHLEKQYKILKSGRKIKVLTLFFIDAVNKY
RDTSSPDGRGEYLRIFDEEYSKIITDKKGKQLFVEYPELFKDYKNVHKVREGYFAVDKHK
NAVEIEDWDKVMDEDKLKAKSQEDIDRGIELILEKKDELISFEEPLAFIFSHSALREGWD
NPNVFTLCTLKKGGSDIAKKQEIGRGLRLSVDIEGTRCTDKTINELTVIANDYYDQFAAA
LQKDFNEQAGFNKEEVTIDVIHASLRNAGIPENKIIDLTEPLRKELIEQNIINKEGMLTK
DAKKIEAITFIHETLQEHSIMIKKAFIEAMQAKGSKKILIKNGDEEPIENGAHSYISEEQ
FEQLLKELGKRMSQRTLYQVNIDSDAFIEESARELNELLRFKRVLYEYNIETGKAEFDEQ
KKFRLSESVQQTFFSEPEGLDLQKSQFEIINYIMYHTLLPRLAIYRIISKLEKATLLKNQ
DILDVVTQKIKEKRTEFMAKGVVRYEAIDGYVFDESTIFEADSIDMGMLEDVASLVFQTS
ADKGRAVHKYYKFDSDGELQFAKRLEEDEKVLLYTKIKKGGFVIDTPYGEYSPDWAVIRK
GEDDQARLFFIVETKIDKEDKDLNEVEKTKIKCGKLHFKAVAQDVQFKQAKNYDDFLLKI
TV
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaaccgtattgcctttcaatttgatgacaagttgggctatcagaaagatgcc
gtcaactctgtcgtcaacctctttaaaggcgttagccgccacgatgacggaactatctat
cgccaactacagagaatgaagaaactcgtcgaaggcgatcctgtgcgcaacccgcaactg
gtttcaccggcaaggctcctgcacaaccttcgcgaggtgcagcaaaagaacaagctgttc
accgatcatgaactgaaagggaacaactttaccatcgagatggaaacaggcacaggcaag
acctacgtgtacctgcggaccattctcgaattataccgcgcttatggctttacgaagttc
atgatcgttgtaccgaccattgccattcgaaaaggcgtagagaaaaccatggccatgttg
cgggaacacttcaaaggcatctacgacggcctggacataatgaaccatgccttcgtctac
gactccaagaacttgaaaaagatcagcagcagttttgtggagacgagagacctcagcatc
gtggtcatgaacatccaggccttcaataaagattccaacaaaatccgtcaatccgacgaa
tatggccagatcctatgggaagacatccggtatattcaccccatcgtcatcatcgacgaa
ccgcaaaaaatcgagggcacagcgaagaagaagagcgcctctctggaagccatcgagggg
atcgatcctttgtttgtcctgcgttattcagccacccataaaagccggtacaaccaggtc
tacaagctcgactccttcgatgcctatcaaaaggatctggtcaagaagatccaggtaaaa
accgtccacggcgccataccgaaagacttcccatacgttcgttacgtagagttcacaaaa
gacctctttgccaagatcgaactgttctgtgtggagcagggcgggcagattcgcaagaag
caggtcaaagttcgaggcggcgattctctttttgaatgttctgggaacctggatcaatac
aaaaacatgttcgtcatggaagatccgcacaagctaaaaaagctgaagatcagcaagtgg
gacgatatcctggagcttgccgtcggagaaaacaatgccgacatcagtgaagaagaaacg
atccgaatccagatcaggctggccattaagagtcacctggagaagcaatacaagatcttg
aagagcggaagaaaaatcaaagtcctcaccttgttcttcatagacgccgtcaacaagtat
cgagacaccagctcccctgatggccgaggggagtacctgcgcatttttgacgaagagtat
agcaagatcatcacggataaaaaggggaagcagctttttgtcgaatacccggagctgttt
aaagattataaaaatgtacacaaggtgagagaaggctattttgccgtcgataagcacaaa
aatgccgtagagattgaagattgggacaaggtgatggatgaagataagctgaaagccaag
tctcaagaagatatcgaccggggcattgaactgatcctagagaagaaagacgagctcata
tcctttgaggaacccttggcgttcatcttctcccactcggcgttgcgggaaggctgggat
aacccgaatgtctttaccctctgcaccttgaaaaaaggcggctccgatattgcaaaaaaa
caagagatcggcagaggattgcgcctctccgtagatattgaaggcacccgatgcacagac
aagacgattaatgaattgaccgtcatcgccaatgattactatgaccagtttgccgcagca
ctccaaaaagattttaatgaacaggccggcttcaataaggaagaagtcaccatcgatgtg
attcatgcctcactccggaatgccggcattccggaaaacaagatcatcgacctgacggaa
ccccttcgaaaagaactgatcgaacagaacatcatcaacaaagagggcatgctgaccaaa
gacgccaagaaaattgaagccatcacctttatccatgaaacgctgcaagagcacagcatc
atgatcaagaaagcgtttattgaagcgatgcaggcaaaaggcagcaagaagattctcatt
aaaaacggcgacgaagaacccatcgagaatggcgcccacagttatatatcagaagagcaa
tttgaacaactgctcaaggaactgggcaagcgcatgtcccaacggaccctctatcaagtt
aacatcgatagtgatgccttcatcgaagaatcggcgagagaactgaacgaactcctgcgg
tttaagcgggtcctctacgaatacaatattgaaacaggcaaggcagagtttgacgaacag
aaaaagttccgcctctctgagtcggtgcaacagacctttttcagtgaaccggaagggctg
gatttgcaaaaaagccaattcgagatcatcaactatatcatgtaccacaccctgctgccc
cgtctggccatttataggatcatatcgaagctggagaaggcaaccctcctaaagaatcaa
gacatcctcgatgtagtgacgcaaaagatcaaggaaaaacgaaccgaattcatggccaaa
ggcgttgtccgctatgaagccattgacggctatgtctttgacgagtcgaccatattcgaa
gccgattcgatcgacatgggcatgcttgaagacgtcgcatcgctcgtctttcaaacgagc
gcagataaaggcagagccgtccataagtattacaagttcgacagcgatggtgaactccaa
ttcgccaaaagactcgaagaagacgaaaaagtgctgctatataccaagatcaaaaaggga
ggcttcgtcattgataccccctatggcgaatattctcctgactgggctgtgatccgtaaa
ggagaggatgatcaagccaggctcttctttatcgtggaaacgaagatagacaaagaggat
aaggatctgaatgaagtggaaaaaacaaagatcaagtgcggcaaacttcacttcaaagcc
gttgcccaagatgttcagtttaagcaagcgaagaattatgacgactttttgctgaagatc
actgtatag

DBGET integrated database retrieval system