KEGG   Heliobacterium modesticaldum: HM1_3141Help
Entry
HM1_3141          CDS       T00653                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha chain, RecD
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HM1_3141
Enzymes [BR:hmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HM1_3141
DNA repair and recombination proteins [BR:hmo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HM1_3141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD HHH_5 AAA_23 PhoH AAA_28 AAA_22 AAA_29 T2SSE NTPase_1 TrwB_AAD_bind UvrD_C FtsK_SpoIIIE AAA_18 UvrD-helicase AAA_16 NACHT cobW AAA
Motif
Other DBs
NCBI-ProteinID: ABZ84899
UniProt: B0TIF8
Position
2339823..2341976
Genome map
AA seq 717 aa AA seqDB search
MTAVGPLLSAETGLSYALEGEWVEHPRFGRQFRFARCRMLPPSTPKAMEKFLSSGLIKGI
GRKTAKKLVCAFGADVLTVLREEPQRLLDMEGLSSDKATTILESYREFAFGENLMTSLNS
YGIDGDLVYRIFRRYGRDSLEVIEANPYRLAIDLRVTFDQCDRIAHRLGFRGDEPKRLQA
ALVYCLYLARDEGHVYLPASELLAQTGNILARSELYPEAPEEKNLHEQVAEAAEAQVIRL
FGDGCYLPELYRAERVVARVLRRLSEEGEPWPVDVESVIATMEEDFGIRYAERQKAAFFG
VANHGLTVITGGPGTGKTTIIRGLIALVNRARPNADIVLCAPTGRAAKRLAETTGQPAFT
VHKALGLRGGKTDPFWDVEPLEADVVIVDEVSMVDIPLMAGLLRALKKGARLVLVGDRDQ
LPSVGPGQVLRDIIEHDVGAILRLNHIFRQAETSAIVTESHRIRSGILPDLSGRKDFLFL
RRNSSAEILDALLQTVNRAIKRAGYGLADVQVLSPMRFTEVGVWNLNKLLQEQLNPMNTG
KREVKAGDHVFRTGDKVMQLKNNYEKDVFNGDLGFIEDILLSGEEETDEDTIVVRFDEGL
VSYGRSEWDQLMLAYATTVHKAQGSEYPVVVMPMTLQHRRMLRRNLVYTAVTRAREKAIL
IGMADALAFAVTNEQDAFRYSGLSQYWGGEAAVEVGEGDLNDEKDLESSHSDQYAQR
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgtgggaccgctgctctcggctgagacgggcttatcctatgccttggaaggc
gagtgggtggagcatccccgtttcggccggcagtttcgctttgcccgttgccgcatgttg
ccgccttcgacccccaaagcgatggaaaagtttttatcgagcgggctgatcaaggggatc
ggacgcaaaacagcaaagaagctggtttgcgccttcggcgccgacgtgctgacggtgctg
cgggaagagccgcagcggcttctcgatatggaagggctatcttcggataaagcgacgact
attttggagtcctaccgggagttcgcttttggggaaaacctgatgacgtcattaaacagt
tatggcatcgacggcgatctggtgtatcgtatatttcggcgctacggccgggacagcctg
gaggtgatcgaggcgaatccctatcggctggctatagatctgcgcgtgacctttgaccaa
tgtgaccgcatcgcccaccggttgggattccgtggagatgaaccgaaacgattgcaggct
gccctcgtctactgtctctatcttgctcgcgatgagggtcatgtctatttgccggcgtcg
gaactgctggcccagacgggaaatatccttgcccggtcggagctatatcccgaggcgccc
gaggaaaagaacctacatgagcaggtggcagaagctgcagaggcgcaggtgatccgcttg
ttcggtgatggttgttacctgcctgaattgtaccgcgctgagcgtgttgttgcccgggta
ttgcgccggttgtcggaagaaggcgagccttggcctgtcgatgtggagtcggtgatcgcc
acgatggaggaggatttcggcatccgttatgccgagaggcagaaggctgctttctttggt
gtggctaatcatgggctgacggtgatcaccggtggtccgggaacagggaagacgacgatt
attcgagggctgatcgcccttgttaaccgcgcccggccgaatgcggacattgttctttgc
gcgccgacaggcagggcagccaagcgcctcgccgagacgacggggcaaccggccttcact
gtccataaggcgcttggtttgcgcggcggtaagacggatcccttctgggatgtagaaccg
ctggaggcggatgtcgtcatcgtcgacgaggtttccatggttgacattcccttgatggca
ggcctgctccgagcgctgaaaaaaggcgcccggctggtgctcgtcggcgaccgggatcaa
ctcccttctgttggaccgggccaggtcctgcgggacatcattgagcatgatgtcggggcc
atccttcgcttgaatcatatttttcgccaagccgagacatcggcgatcgtgacggagtct
caccggatccgatcaggcatccttcctgatctgtccggtcgcaaggacttcctctttcta
cggcgcaacagcagtgctgagatattggacgcgctgttgcagacggtgaaccgcgccatt
aaacgggccggttacggccttgccgatgtacaggtgctctctccgatgcgtttcactgag
gttggtgtttggaacctcaacaagttgctgcaggagcaattgaatcctatgaacacaggt
aagagagaggttaaagccggagaccatgtctttcgcaccggcgacaaggtgatgcaactg
aaaaataactatgaaaaagatgtatttaatggcgatctcggttttattgaggacatactg
ctaagcggggaggaagagactgacgaggataccatcgtcgtgcgtttcgacgagggactt
gtatcctacgggcggtccgagtgggatcaattgatgctcgcttatgccaccacggtacat
aaagcgcaggggagtgaataccccgttgtggtcatgccgatgacccttcaacatcggagg
atgctgcggcgcaacctggtttacacggcggtgacacgagctcgtgaaaaggctatcctg
atcggcatggctgatgcgctcgcttttgcggtcacaaatgaacaggacgcttttcgttac
agcggactttctcagtattggggtggggaagctgcggtggaagtgggggaaggcgatctg
aacgatgaaaaggacctcgaatcatcgcactctgatcagtatgcccagagataa

DBGET integrated database retrieval system