KEGG   Heliobacterium modesticaldum: HM1_3141Help
Entry
HM1_3141          CDS       T00653                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hmo  Heliobacterium modesticaldum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hmo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2339823..2341976
Genome map
AA seq 717 aa AA seqDB search
MTAVGPLLSAETGLSYALEGEWVEHPRFGRQFRFARCRMLPPSTPKAMEKFLSSGLIKGI
GRKTAKKLVCAFGADVLTVLREEPQRLLDMEGLSSDKATTILESYREFAFGENLMTSLNS
YGIDGDLVYRIFRRYGRDSLEVIEANPYRLAIDLRVTFDQCDRIAHRLGFRGDEPKRLQA
ALVYCLYLARDEGHVYLPASELLAQTGNILARSELYPEAPEEKNLHEQVAEAAEAQVIRL
FGDGCYLPELYRAERVVARVLRRLSEEGEPWPVDVESVIATMEEDFGIRYAERQKAAFFG
VANHGLTVITGGPGTGKTTIIRGLIALVNRARPNADIVLCAPTGRAAKRLAETTGQPAFT
VHKALGLRGGKTDPFWDVEPLEADVVIVDEVSMVDIPLMAGLLRALKKGARLVLVGDRDQ
LPSVGPGQVLRDIIEHDVGAILRLNHIFRQAETSAIVTESHRIRSGILPDLSGRKDFLFL
RRNSSAEILDALLQTVNRAIKRAGYGLADVQVLSPMRFTEVGVWNLNKLLQEQLNPMNTG
KREVKAGDHVFRTGDKVMQLKNNYEKDVFNGDLGFIEDILLSGEEETDEDTIVVRFDEGL
VSYGRSEWDQLMLAYATTVHKAQGSEYPVVVMPMTLQHRRMLRRNLVYTAVTRAREKAIL
IGMADALAFAVTNEQDAFRYSGLSQYWGGEAAVEVGEGDLNDEKDLESSHSDQYAQR
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgtgggaccgctgctctcggctgagacgggcttatcctatgccttggaaggc
gagtgggtggagcatccccgtttcggccggcagtttcgctttgcccgttgccgcatgttg
ccgccttcgacccccaaagcgatggaaaagtttttatcgagcgggctgatcaaggggatc
ggacgcaaaacagcaaagaagctggtttgcgccttcggcgccgacgtgctgacggtgctg
cgggaagagccgcagcggcttctcgatatggaagggctatcttcggataaagcgacgact
attttggagtcctaccgggagttcgcttttggggaaaacctgatgacgtcattaaacagt
tatggcatcgacggcgatctggtgtatcgtatatttcggcgctacggccgggacagcctg
gaggtgatcgaggcgaatccctatcggctggctatagatctgcgcgtgacctttgaccaa
tgtgaccgcatcgcccaccggttgggattccgtggagatgaaccgaaacgattgcaggct
gccctcgtctactgtctctatcttgctcgcgatgagggtcatgtctatttgccggcgtcg
gaactgctggcccagacgggaaatatccttgcccggtcggagctatatcccgaggcgccc
gaggaaaagaacctacatgagcaggtggcagaagctgcagaggcgcaggtgatccgcttg
ttcggtgatggttgttacctgcctgaattgtaccgcgctgagcgtgttgttgcccgggta
ttgcgccggttgtcggaagaaggcgagccttggcctgtcgatgtggagtcggtgatcgcc
acgatggaggaggatttcggcatccgttatgccgagaggcagaaggctgctttctttggt
gtggctaatcatgggctgacggtgatcaccggtggtccgggaacagggaagacgacgatt
attcgagggctgatcgcccttgttaaccgcgcccggccgaatgcggacattgttctttgc
gcgccgacaggcagggcagccaagcgcctcgccgagacgacggggcaaccggccttcact
gtccataaggcgcttggtttgcgcggcggtaagacggatcccttctgggatgtagaaccg
ctggaggcggatgtcgtcatcgtcgacgaggtttccatggttgacattcccttgatggca
ggcctgctccgagcgctgaaaaaaggcgcccggctggtgctcgtcggcgaccgggatcaa
ctcccttctgttggaccgggccaggtcctgcgggacatcattgagcatgatgtcggggcc
atccttcgcttgaatcatatttttcgccaagccgagacatcggcgatcgtgacggagtct
caccggatccgatcaggcatccttcctgatctgtccggtcgcaaggacttcctctttcta
cggcgcaacagcagtgctgagatattggacgcgctgttgcagacggtgaaccgcgccatt
aaacgggccggttacggccttgccgatgtacaggtgctctctccgatgcgtttcactgag
gttggtgtttggaacctcaacaagttgctgcaggagcaattgaatcctatgaacacaggt
aagagagaggttaaagccggagaccatgtctttcgcaccggcgacaaggtgatgcaactg
aaaaataactatgaaaaagatgtatttaatggcgatctcggttttattgaggacatactg
ctaagcggggaggaagagactgacgaggataccatcgtcgtgcgtttcgacgagggactt
gtatcctacgggcggtccgagtgggatcaattgatgctcgcttatgccaccacggtacat
aaagcgcaggggagtgaataccccgttgtggtcatgccgatgacccttcaacatcggagg
atgctgcggcgcaacctggtttacacggcggtgacacgagctcgtgaaaaggctatcctg
atcggcatggctgatgcgctcgcttttgcggtcacaaatgaacaggacgcttttcgttac
agcggactttctcagtattggggtggggaagctgcggtggaagtgggggaaggcgatctg
aacgatgaaaaggacctcgaatcatcgcactctgatcagtatgcccagagataa

DBGET integrated database retrieval system