KEGG   Hippea maritima: Hipma_0057Help
Entry
Hipma_0057        CDS       T01456                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hmr  Hippea maritima
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Hipma_0057
Enzymes [BR:hmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Hipma_0057
Transfer RNA biogenesis [BR:hmr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Hipma_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59290..60198)
Genome map
AA seq 302 aa AA seqDB search
MKEFLSDLLAQVIFTAVKAGGKIMEIYHKDFSVKYKDDKSPLTEADKLSNEIICDGLKQL
TPAPRHTPTPTLTRIPILSEENKEIPYDDRKNWDIFWLVDPLDGTKEFIKKNGEFTVNIA
LIHKDSPVLGVVYAPAINTLYYAAKGLGAYKSVNSETVNSERRMNEILKNSVKLPVERDD
KDLIVVASRSHMNQETQNFIEALKESSLFTNHSSLITTSIGSSLKICLVAEGKADIYPRL
GPTMEWDTAAAHAIVKEAGGEIYIYDSSMFNVQSSNLIQNPESKIQNFQLDAQHPTPNTQ
YL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttttatcagatttattggctcaagtaatattcacagcagtgaaagcaggt
ggaaagataatggaaatatatcataaagatttttcagttaaatacaaagatgacaaaagt
ccacttacggaggctgacaaattatccaatgagataatttgcgatggtcttaaacaactc
acaccagcacctagacacacacccacacctacacttacacgaatccccatcctcagtgaa
gaaaataaagaaattccctatgatgatagaaaaaactgggacatattctggcttgttgat
cctttggatggtacaaaggaatttattaaaaagaatggagaatttacggttaatattgct
ttaattcataaagattcacctgttcttggtgttgtatatgcaccagcgattaatacatta
tattatgcagcaaaaggattgggagcatataaatcagtgaatagtgaaacagtgaacagt
gaaaggagaatgaatgaaattttgaaaaattcggttaagttacctgttgaaagagatgat
aaagatttaattgtagttgcaagtaggtcgcatatgaatcaagaaactcaaaattttata
gaggctttaaaagaatcttcactcttcactaatcactcttcactaatcactacttctatt
ggaagtagtctgaaaatttgtttagtagctgagggtaaagctgacatttatccacgcctt
ggacctacgatggagtgggacactgcagcagcacatgccattgttaaagaagccggaggg
gaaatatatatatacgatagttcaatgttcaatgttcaaagttcaaacttaatccaaaat
ccagaatccaaaatccaaaattttcaattggatgcccaacacccaacacccaatacccaa
tacctttaa

DBGET integrated database retrieval system