KEGG   Hippea maritima: Hipma_0138Help
Entry
Hipma_0138        CDS       T01456                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hmr  Hippea maritima
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_0138
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hipma_0138
   00650 Butanoate metabolism
    Hipma_0138
  Energy metabolism
   00190 Oxidative phosphorylation
    Hipma_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138334..138705
Genome map
AA seq 123 aa AA seqDB search
MEYMRGFIDRYQGSGKGGDLSWLLQRVSGVALLVLLLGHFFIEHFVGGPLDYQHVAARLA
SPLWKVFDLTFVVFALYHGINGIFMNIEDYVHSGWRVFWKGFFWVVGIIYLVLAAITILP
FKG
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggagtatatgagaggtttcatagataggtatcaaggaagcggtaaaggtggcgattta
agctggctgcttcaaagggtatctggtgttgctttgctggttcttttattgggacacttt
ttcatagagcactttgttggaggtcctttggattatcaacatgttgcagcaagacttgct
tcccctctatggaaggtatttgatctaactttcgttgtatttgctctttatcacggaata
aatggtatatttatgaacattgaagattatgttcactcaggctggagggtattctggaaa
ggattcttctgggtagtgggtataatttatcttgttttagcagcgataacaatactacca
tttaagggttaa

DBGET integrated database retrieval system