KEGG   Hippea maritima: Hipma_0142Help
Entry
Hipma_0142        CDS       T01456                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hmr  Hippea maritima
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hmr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(142764..143333)
Genome map
AA seq 189 aa AA seqDB search
MLEAVRGTLVDKTNLKAVIDVNGLMLDISIPLSTFNKLPEIGEECTLLCELVIGEKSLKL
YGFSTKEEKNLFNSLRKISKIGAQTAISILSNISIEQFYRAIEEQNKELLTKIPGIGKKT
AISIIVEFSSKIPKTDNPPIVDDAITTLQGLGFSQSDASKIVNEIYRNKPNITIEDLIKE
SLKNIKHVS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgttagaggcagtaagaggaacccttgtagacaaaactaacctaaaagctgtgattgat
gtaaacggcttgatgcttgatatatctattccactttctacattcaataagttacccgag
ataggagaggagtgtaccctgttatgtgaacttgtaattggtgaaaaaagcctaaaatta
tacggcttttcaacaaaagaggaaaaaaacctgttcaacagcctgcgcaagatatcaaag
ataggcgcacaaacggccatatctattctctccaatatttccatagaacaattctataga
gcaattgaagagcaaaacaaggagcttttaacaaaaatcccaggaattggcaaaaaaaca
gccatatcaataatcgtcgaattttcatcaaagatcccaaaaaccgataatccacccatc
gttgatgatgctattacaactttacagggcttaggcttctctcagtctgacgcttcaaaa
attgttaatgaaatttacagaaacaaacctaacataactatagaagacctcataaaggaa
tctctaaaaaatataaagcatgtcagctga

DBGET integrated database retrieval system