KEGG   Hippea maritima: Hipma_0159Help
Entry
Hipma_0159        CDS       T01456                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hmr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hmr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hmr00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hmr00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hmr00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
158486..159220
Genome map
AA seq 244 aa AA seqDB search
MMRNIIAANWKMHFDLDSAIQVASQMKDDLSSFGKTEIIVCPSFVFLHPLANIFNESNIK
LGAQNVYFEDKGAFTGEVSPSMLKSVGCEYVIIGHSERRHIFLESDIDIQKKVKKALEYN
LKPILCVGETLSQRKEDKAFDVVERQIISALDGVDLNKVIIAYEPVWAIGTGVAADEATV
GEMHNFLANLVEDVPILYGGSVKPENAFNLAKIDTVNGFLVGSASLDTGSLKRIIVEFEK
AKGV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaatataattgctgccaattggaaaatgcattttgaccttgatagtgctata
caagtggcatctcagatgaaagatgacctgagtagttttggtaaaaccgaaatcattgtt
tgtcccagttttgtgtttttacatccactggctaatatttttaatgaatctaatatcaag
ctcggcgcacaaaatgtatattttgaggataaaggagcattcaccggggaagtttcaccg
tccatgctaaaaagcgtaggctgtgaatatgtaataataggtcactctgaaagaaggcat
atatttcttgaaagtgatatagatatccagaaaaaggtaaaaaaagccttagaatacaac
cttaagcccattctttgtgtgggtgagacactctctcaaagaaaagaggacaaggcattc
gatgttgttgaaaggcagattatctcagcgcttgatggtgttgatttgaataaggtaatt
attgcatatgagcctgtttgggctattggcacaggcgttgctgctgatgaggctaccgtt
ggggagatgcacaactttttagctaatttagttgaagacgttccgattctatatggtgga
agtgtaaagccagaaaacgcctttaaccttgcaaaaatagatacagtaaatggatttttg
gttggctctgcaagtttggatacaggcagcttaaaaagaattatagtggaattcgagaaa
gcaaagggggtttga

DBGET integrated database retrieval system