KEGG   Hippea maritima: Hipma_0159Help
Entry
Hipma_0159        CDS       T01456                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_0159
   01230 Biosynthesis of amino acids
    Hipma_0159
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0159
   00051 Fructose and mannose metabolism
    Hipma_0159
   00562 Inositol phosphate metabolism
    Hipma_0159
Enzymes [BR:hmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hipma_0159
Exosome [BR:hmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hipma_0159
  Exosomal proteins of bladder cancer cells
   Hipma_0159
  Exosomal proteins of melanoma cells
   Hipma_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
158486..159220
Genome map
AA seq 244 aa AA seqDB search
MMRNIIAANWKMHFDLDSAIQVASQMKDDLSSFGKTEIIVCPSFVFLHPLANIFNESNIK
LGAQNVYFEDKGAFTGEVSPSMLKSVGCEYVIIGHSERRHIFLESDIDIQKKVKKALEYN
LKPILCVGETLSQRKEDKAFDVVERQIISALDGVDLNKVIIAYEPVWAIGTGVAADEATV
GEMHNFLANLVEDVPILYGGSVKPENAFNLAKIDTVNGFLVGSASLDTGSLKRIIVEFEK
AKGV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaatataattgctgccaattggaaaatgcattttgaccttgatagtgctata
caagtggcatctcagatgaaagatgacctgagtagttttggtaaaaccgaaatcattgtt
tgtcccagttttgtgtttttacatccactggctaatatttttaatgaatctaatatcaag
ctcggcgcacaaaatgtatattttgaggataaaggagcattcaccggggaagtttcaccg
tccatgctaaaaagcgtaggctgtgaatatgtaataataggtcactctgaaagaaggcat
atatttcttgaaagtgatatagatatccagaaaaaggtaaaaaaagccttagaatacaac
cttaagcccattctttgtgtgggtgagacactctctcaaagaaaagaggacaaggcattc
gatgttgttgaaaggcagattatctcagcgcttgatggtgttgatttgaataaggtaatt
attgcatatgagcctgtttgggctattggcacaggcgttgctgctgatgaggctaccgtt
ggggagatgcacaactttttagctaatttagttgaagacgttccgattctatatggtgga
agtgtaaagccagaaaacgcctttaaccttgcaaaaatagatacagtaaatggatttttg
gttggctctgcaagtttggatacaggcagcttaaaaagaattatagtggaattcgagaaa
gcaaagggggtttga

DBGET integrated database retrieval system