KEGG   Hippea maritima: Hipma_0159Help
Entry
Hipma_0159        CDS       T01456                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_0159
   01230 Biosynthesis of amino acids
    Hipma_0159
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0159
   00051 Fructose and mannose metabolism
    Hipma_0159
   00562 Inositol phosphate metabolism
    Hipma_0159
Enzymes [BR:hmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hipma_0159
Exosome [BR:hmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hipma_0159
  Exosomal proteins of bladder cancer cells
   Hipma_0159
  Exosomal proteins of melanoma cells
   Hipma_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
158486..159220
Genome map
AA seq 244 aa AA seqDB search
MMRNIIAANWKMHFDLDSAIQVASQMKDDLSSFGKTEIIVCPSFVFLHPLANIFNESNIK
LGAQNVYFEDKGAFTGEVSPSMLKSVGCEYVIIGHSERRHIFLESDIDIQKKVKKALEYN
LKPILCVGETLSQRKEDKAFDVVERQIISALDGVDLNKVIIAYEPVWAIGTGVAADEATV
GEMHNFLANLVEDVPILYGGSVKPENAFNLAKIDTVNGFLVGSASLDTGSLKRIIVEFEK
AKGV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaatataattgctgccaattggaaaatgcattttgaccttgatagtgctata
caagtggcatctcagatgaaagatgacctgagtagttttggtaaaaccgaaatcattgtt
tgtcccagttttgtgtttttacatccactggctaatatttttaatgaatctaatatcaag
ctcggcgcacaaaatgtatattttgaggataaaggagcattcaccggggaagtttcaccg
tccatgctaaaaagcgtaggctgtgaatatgtaataataggtcactctgaaagaaggcat
atatttcttgaaagtgatatagatatccagaaaaaggtaaaaaaagccttagaatacaac
cttaagcccattctttgtgtgggtgagacactctctcaaagaaaagaggacaaggcattc
gatgttgttgaaaggcagattatctcagcgcttgatggtgttgatttgaataaggtaatt
attgcatatgagcctgtttgggctattggcacaggcgttgctgctgatgaggctaccgtt
ggggagatgcacaactttttagctaatttagttgaagacgttccgattctatatggtgga
agtgtaaagccagaaaacgcctttaaccttgcaaaaatagatacagtaaatggatttttg
gttggctctgcaagtttggatacaggcagcttaaaaagaattatagtggaattcgagaaa
gcaaagggggtttga

DBGET integrated database retrieval system