KEGG   Hippea maritima: Hipma_0219Help
Entry
Hipma_0219        CDS       T01456                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hmr  Hippea maritima
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hipma_0219
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Hipma_0219
Enzymes [BR:hmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Hipma_0219
Two-component system [BR:hmr02022]
 CheA family
  CheA-CheYBV
   Hipma_0219
Bacterial motility proteins [BR:hmr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Hipma_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215945..217030
Genome map
AA seq 361 aa AA seqDB search
MESKVRVLVVDDSLISRKYLRRILEESGKIEVIDTAKDGQEAIEKIKSLKPDVVTLDIEM
PRLNGLDALKIIMKDHPVPVIMVSSLTKDGAEETLQALRLGAVDYISKNDVLSFKSAAKE
ARQILIEKILSAKNSRIRGRRLKAKATSIIHKEKEEKPEEISQGPKKKPEKLDIRVVAIA
ASTGGPVALEKVFSELPLLGVPIMIVQHMPKTFTGVFANSLSKVSKIKVKEAEDGEELRS
NQGYLAPGGMQMTASKSGSKYIVRVSDEPKTIYTPNANVMFKSVAETFGDKALCVIMTGM
GDDGFKGLQEVARVGGTIIAQDKDSCVVWGMPRKPTQTGLADFVVPLDKIASTISKIVLG
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtaagagttttggttgtggatgactctttgatttctcgtaaatacctt
aggcgaattttggaagaatctggtaaaattgaagttatagatacagctaaagatggccaa
gaggctatagaaaaaataaagtctttaaaaccagatgttgttacgcttgacatagaaatg
ccgcgtctgaatggacttgatgcattgaaaattattatgaaagaccaccccgtgccggtt
ataatggttagctctttaacgaaggatggagcagaggaaacgcttcaggctcttcgtttg
ggagctgttgattatatatcaaaaaacgatgtactttcctttaagtctgcggccaaggaa
gcaaggcagattttaattgagaagatcttatctgctaaaaactcaagaattagaggtaga
agactaaaagctaaagccacctcaattattcataaagaaaaagaagaaaagcccgaggag
atatcgcaaggccctaagaaaaaaccagagaaattggatataagggttgtggcaatagca
gcttcgaccggtggccctgtcgcacttgaaaaggttttctcagaacttcccttactgggt
gtgcctataatgatagtgcaacatatgcccaagacatttacaggtgtttttgctaactct
ttaagtaaagtatcgaagataaaggtaaaagaggctgaggatggtgaggaattaaggtct
aatcagggctatttagcccctggaggcatgcagatgaccgcctccaaaagtggatcaaag
tatatagttagagttagtgatgagcctaagaccatatatacccctaatgctaatgttatg
tttaaatctgtagctgaaacattcggggataaagctctttgtgttattatgactggtatg
ggtgatgatggctttaaggggttgcaggaagttgcaagggttggaggaacgattatagct
caagataaggatagttgtgttgtctggggcatgcccagaaaaccgacgcagactggctta
gcagattttgttgttcctcttgataaaatagcttccactatatccaaaatagtgcttggc
aggtag

DBGET integrated database retrieval system