KEGG   Hippea maritima: Hipma_0432Help
Entry
Hipma_0432        CDS       T01456                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hmr  Hippea maritima
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hipma_0432
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hipma_0432
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hipma_0432
Enzymes [BR:hmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hipma_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
433182..434531
Genome map
AA seq 449 aa AA seqDB search
MERKILLKEDEMPRYWYNILPDMPTPVKPPINPKTMKPINPDDLKAIFPSEIIEQEMSSQ
REISIPQEVLDIYAIWRPTPLVRAYNLEKALGTPAKIYYKNESVSPAGSHKPNTAIAQAY
YNKKEGITTLTTETGAGQWGSALALAGALLGLNVRVYMVKVSYEQKPFRRSMIHLWGAEV
YPSPSDKTEAGRRALEENPDNPGSLGLAISEAVEDAATHDNTNYALGSVLNHVLLHQTVI
GLEAQKQFEKIGDYPDVIFAPCGGGSNLGGVGLPFIRDKINGKDVRVVAVEPASCPTLTK
GIFTYDYADVAMMTPLLYMYTLGHKFMPPSIHAGGLRYHGDSPILSQLRKDGLLDAVAYN
QTEVFEAGALFAKTEGIVPAPETCHAIKGAVDEALKAKEEGKEKTILINFSGHGHFDMTS
YDKFLSGEMKDYEYPEKEIKKALDYLPKV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggagaggaagatacttttaaaagaggatgaaatgccgaggtattggtataatattctg
ccggatatgcccacacctgttaaaccaccgatcaatcctaagacgatgaagcctataaat
ccggatgaccttaaagctatattcccatcagagattatagagcaggagatgagtagtcaa
agggagatctccataccgcaggaggtgttagatatttatgctatctggaggccgacgcct
ttggttagggcttacaatcttgagaaggccttaggaacaccggcaaagatttactataaa
aacgaatcggtctctcctgctggaagccacaaacccaatacggctatagcacaagcctac
tacaataaaaaggagggtataacgaccctaacaacagaaacaggcgcaggccagtggggt
tctgctttggcgttggcaggcgctttgttggggttaaatgtcagggtctatatggttaaa
gttagctatgagcagaaaccctttaggcgttcgatgatccatctatggggagctgaggtc
tatccatcgcccagcgataagaccgaggctggcagaagggccttagaggaaaaccctgat
aacccggggagtttgggtcttgctatcagcgaggcggttgaggatgcagcaacgcatgat
aacaccaattatgccttaggtagtgttttgaatcatgttctgctccatcagactgtgata
ggccttgaggctcaaaaacagtttgaaaagataggcgattatccagatgttatatttgca
ccatgtggtggcggcagtaatcttggtggtgtgggtttgccctttattagggataagata
aacggcaaggatgttagggttgtggcagttgagcctgcaagctgcccgacattgaccaag
ggtatattcacatacgattatgcggatgtagctatgatgacccccttgctttatatgtac
acattggggcataaatttatgccacccagcattcatgctggtggtttgagatatcacggt
gattcgcccattttgagtcaactaagaaaagatggattgttggatgctgttgcctacaat
caaacagaggtgtttgaggcaggcgctctgtttgcaaaaacagagggtatagttcctgcg
cctgagacatgtcatgcaataaaaggggcagtagatgaggccttaaaagctaaggaagag
ggtaaagagaaaactatactgataaacttctccggtcatggacactttgatatgacctca
tatgataagtttctatctggggagatgaaggattacgaatatccagaaaaagaaattaaa
aaagccttagattacttacctaaggtttaa

DBGET integrated database retrieval system