KEGG   Hippea maritima: Hipma_0461Help
Entry
Hipma_0461        CDS       T01456                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hmr  Hippea maritima
Brite
Enzymes [BR:hmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hipma_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(463202..463804)
Genome map
AA seq 200 aa AA seqDB search
MKTNDELIDYLEKSIGILKTPAIIEAFRSIDRTDFVREGYKREAYQNYPLPIGNSQTISQ
PYTVAFMLELLQPKEDSHILDVGCGSCYTTALLAKIAKKGKVVGVEIDKKLVEFCKSNLR
KYDFNNIEIYNADKLPPTKSKFDRILVSAAAERLPEELLNALKEGGRMVIPVQSSIFLIE
KQNNKIKMQEHYGFAFVRLR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaatgatgaacttatagattacctcgaaaaatccataggcattcttaaaaca
ccggcaataatagaggcattcaggtcaatagacaggactgattttgtaagagagggatac
aaaagagaagcttaccaaaactatccccttcctataggaaactctcaaaccatatcacaa
ccctatactgtagccttcatgttagaactattgcaaccaaaagaagatagtcatatctta
gatgttgggtgtggaagttgctatactacggctctacttgctaagattgcaaaaaaaggc
aaggtggtaggagtggaaatagacaaaaaactcgtagagttttgcaaaagcaatctaaga
aaatatgacttcaataatatagaaatctacaacgcagataagttgccacctacaaagagt
aaattcgataggattttagtctcagcagcagcagaaaggcttccagaagaactcctgaac
gcattaaaagaaggtggcagaatggttatacctgtgcaatcatccatttttctaatagaa
aaacagaacaataaaattaaaatgcaagagcattacgggttcgcattcgtaagattgagg
taa

DBGET integrated database retrieval system