KEGG   Hippea maritima: Hipma_0494Help
Entry
Hipma_0494        CDS       T01456                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hmr  Hippea maritima
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hmr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(500330..500881)
Genome map
AA seq 183 aa AA seqDB search
MIGEFRRIGNMMFLSGLVDASSGNMSFKAKDGVWITKTGKSLYNLRGKDIVKIGFERDVR
WNAASSEVEIHINIYKLNKKSKAILHAHSISTIILSLKGYKTIEPIDYEGSLFLKSVDIL
DIPYNNWQTAKEIIPQYLKETQKQIVVAKGHGVFAYSDTLFGALQLISALENSSKIILGV
EGD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgataggggaatttagacgtatagggaatatgatgtttctttcaggccttgtggatgca
tcaagcggcaatatgagttttaaggcaaaagatggagtatggataacaaagacgggaaag
agcctgtacaacttaagaggcaaagacatagtaaagattggttttgagagggatgtaaga
tggaatgctgcatcaagtgaggttgaaattcatataaatatttacaaattaaacaaaaaa
tccaaggctatcctgcatgctcactctatatctaccatcatcctttccctcaagggatat
aaaacaatagaaccaatagactatgaaggaagcttgtttttaaagagtgtagacatcctg
gatataccctacaataactggcaaacagcaaaagagattattccgcaatacttaaaagaa
acccaaaaacagatagttgtagctaaaggacatggtgtttttgcctattccgatacactt
tttggagcactacagctaataagtgctctggagaattcatcaaaaataatcttgggtgtt
gaaggtgattga

DBGET integrated database retrieval system