KEGG   Hippea maritima: Hipma_0577Help
Entry
Hipma_0577        CDS       T01456                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hmr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hmr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hmr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hmr00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:hmr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584175..586202
Genome map
AA seq 675 aa AA seqDB search
MGKQKGVIESKLKENRVFHPSIDFAQKANIDSDEYERLKKWAESDWEGFWKYFAIKKIDW
FKRFDDVLDDSNPPFYKFFVGGKLNVSYNCLDRHIKSWRKNKAAIIWESENGDTRIMTYQ
ELYIEVNKFASVLKTLGVKKGDRVLIYMPMIPEAAVAMLASVRIGAVHSVVFGGFSAEAL
RDRIEDAKPKIIITADGGFRNGKAIPLKSKVDDAMSGVEHKVDYVVVVRHIDRDIHMKPL
RDFWYQDLMGDPDYAQIYCQPETMDSEDPLFILYTSGSTGKPKGVVHSTAGYLLWTMLTM
KWVFDIKDEDTFWCTADIGWITGHSYGVYGPLAMGSTTVMYEGVPTYPTPAKWWELVEKH
SINILYTAPTAIRALMRLGNEWVLKHDLSSLRLLGTVGEPINPEAWMWYYQTVGNERSPI
VDTWWQTETGGHMITTVPGAQTAKPGSAGMPLPGIFAEIVDTEGNPINDPNKGGLLVITK
PWPSMLRTVWGDDNRFIETYWKKFKNKGYYFAGDGARKDEDGYFWIMGRVDDVLNVSGHR
IGTMEVESALVSHRYVAEAAVVGRPDDITGEAIVAFVVLKEGVDKTHHDELVRELREHVQ
KEIGPIARPQEIIFTDTLPKTRSGKIMRRLLKDIASGKKIEQDISTLEDASVLDKLAELR
DKMEEEMNKNGNSKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacaaaaaggtgttatcgaatctaaacttaaagaaaacagggtttttcatcct
tcaattgattttgctcagaaagcaaatatagattctgatgaatatgaaagattgaagaag
tgggccgaaagcgactgggaaggtttttggaaatattttgctataaaaaaaatagactgg
tttaaaaggtttgatgatgtattagatgactccaatccaccattctataaattttttgtt
ggcggaaaactcaatgtttcttataactgcttggatagacatataaaaagctggagaaaa
aataaggcggcaattatttgggaaagtgaaaatggcgatacacgcattatgacctatcaa
gaactttatatagaggtcaataaatttgcaagcgttctgaaaacattgggtgtgaaaaag
ggcgatagggttttgatatatatgcctatgatacctgaagctgctgttgctatgcttgca
agtgtccgtattggtgctgttcatagtgttgtttttggtggtttttccgcagaggcttta
agggacagaatagaagatgctaaacccaagataataattactgcagatggtggatttaga
aacggtaaggctattcctttaaaaagtaaagttgatgatgctatgtctggtgttgagcat
aaggttgattatgttgttgttgtaaggcatatagacagagacatacatatgaaaccgttg
agagatttttggtatcaagatcttatgggtgatcccgattatgctcaaatttactgccag
cctgaaactatggactctgaagatccacttttcattctctatacgtcgggttccactggc
aaacccaaaggcgttgttcattcaacggcgggttatctgttatggactatgcttacaatg
aagtgggtttttgatataaaggatgaggatacattctggtgtactgcagatattggttgg
attaccggtcattcctacggtgtgtatggacccttggctatgggttctacaacagttatg
tatgagggtgttccaacatatccaacacctgcaaagtggtgggagcttgttgaaaagcat
tcaataaatatattatacacagcgcctacggctattagagctttgatgaggttaggcaat
gaatgggttttgaaacatgatttatcgtcattgagactcttgggtaccgttggtgagcct
ataaatccagaggcatggatgtggtattaccagacagtcggaaacgagagatctcccatc
gtggatacatggtggcaaacagaaactggagggcacatgataacaacagttccaggggct
cagactgcaaaacccggctcagctggaatgccacttccgggtatttttgctgaaatcgtt
gatacagagggaaatcctataaatgatccaaataagggcggcttgcttgttataacaaaa
ccatggccttctatgttgcggactgtttggggtgatgataacagatttattgagacctat
tggaagaaatttaagaacaaaggatattactttgccggtgatggtgcaaggaaagatgag
gatggctacttctggattatgggtagggttgatgatgtcctgaacgtttctgggcatagg
ataggaacgatggaagttgagagtgctttagtctcacataggtatgtggctgaggctgct
gtagttggtaggccggatgatatcacaggtgaggctattgtagcattcgttgtacttaaa
gagggtgttgataagacgcatcacgatgagcttgtaagagagctaagagagcatgtgcaa
aaggaaataggtcctatagcaagacctcaggagataatatttacagacacccttccaaaa
acccgttcaggaaaaatcatgagaaggctgcttaaggatatagcatctggtaagaagata
gagcaggatatatctacacttgaggatgcttctgtgttggataaacttgctgaactcagg
gataaaatggaagaggagatgaacaaaaacggaaactctaaaaaatag

DBGET integrated database retrieval system