KEGG   Hippea maritima: Hipma_0577Help
Entry
Hipma_0577        CDS       T01456                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hmr  Hippea maritima
Pathway
hmr00010  Glycolysis / Gluconeogenesis
hmr00620  Pyruvate metabolism
hmr00640  Propanoate metabolism
hmr00680  Methane metabolism
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01120  Microbial metabolism in diverse environments
hmr01130  Biosynthesis of antibiotics
hmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0577
   00620 Pyruvate metabolism
    Hipma_0577
   00640 Propanoate metabolism
    Hipma_0577
  Energy metabolism
   00680 Methane metabolism
    Hipma_0577
Enzymes [BR:hmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hipma_0577
Lipid biosynthesis proteins [BR:hmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hipma_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEA33547
UniProt: F2LUU2
Position
584175..586202
Genome map
AA seq 675 aa AA seqDB search
MGKQKGVIESKLKENRVFHPSIDFAQKANIDSDEYERLKKWAESDWEGFWKYFAIKKIDW
FKRFDDVLDDSNPPFYKFFVGGKLNVSYNCLDRHIKSWRKNKAAIIWESENGDTRIMTYQ
ELYIEVNKFASVLKTLGVKKGDRVLIYMPMIPEAAVAMLASVRIGAVHSVVFGGFSAEAL
RDRIEDAKPKIIITADGGFRNGKAIPLKSKVDDAMSGVEHKVDYVVVVRHIDRDIHMKPL
RDFWYQDLMGDPDYAQIYCQPETMDSEDPLFILYTSGSTGKPKGVVHSTAGYLLWTMLTM
KWVFDIKDEDTFWCTADIGWITGHSYGVYGPLAMGSTTVMYEGVPTYPTPAKWWELVEKH
SINILYTAPTAIRALMRLGNEWVLKHDLSSLRLLGTVGEPINPEAWMWYYQTVGNERSPI
VDTWWQTETGGHMITTVPGAQTAKPGSAGMPLPGIFAEIVDTEGNPINDPNKGGLLVITK
PWPSMLRTVWGDDNRFIETYWKKFKNKGYYFAGDGARKDEDGYFWIMGRVDDVLNVSGHR
IGTMEVESALVSHRYVAEAAVVGRPDDITGEAIVAFVVLKEGVDKTHHDELVRELREHVQ
KEIGPIARPQEIIFTDTLPKTRSGKIMRRLLKDIASGKKIEQDISTLEDASVLDKLAELR
DKMEEEMNKNGNSKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacaaaaaggtgttatcgaatctaaacttaaagaaaacagggtttttcatcct
tcaattgattttgctcagaaagcaaatatagattctgatgaatatgaaagattgaagaag
tgggccgaaagcgactgggaaggtttttggaaatattttgctataaaaaaaatagactgg
tttaaaaggtttgatgatgtattagatgactccaatccaccattctataaattttttgtt
ggcggaaaactcaatgtttcttataactgcttggatagacatataaaaagctggagaaaa
aataaggcggcaattatttgggaaagtgaaaatggcgatacacgcattatgacctatcaa
gaactttatatagaggtcaataaatttgcaagcgttctgaaaacattgggtgtgaaaaag
ggcgatagggttttgatatatatgcctatgatacctgaagctgctgttgctatgcttgca
agtgtccgtattggtgctgttcatagtgttgtttttggtggtttttccgcagaggcttta
agggacagaatagaagatgctaaacccaagataataattactgcagatggtggatttaga
aacggtaaggctattcctttaaaaagtaaagttgatgatgctatgtctggtgttgagcat
aaggttgattatgttgttgttgtaaggcatatagacagagacatacatatgaaaccgttg
agagatttttggtatcaagatcttatgggtgatcccgattatgctcaaatttactgccag
cctgaaactatggactctgaagatccacttttcattctctatacgtcgggttccactggc
aaacccaaaggcgttgttcattcaacggcgggttatctgttatggactatgcttacaatg
aagtgggtttttgatataaaggatgaggatacattctggtgtactgcagatattggttgg
attaccggtcattcctacggtgtgtatggacccttggctatgggttctacaacagttatg
tatgagggtgttccaacatatccaacacctgcaaagtggtgggagcttgttgaaaagcat
tcaataaatatattatacacagcgcctacggctattagagctttgatgaggttaggcaat
gaatgggttttgaaacatgatttatcgtcattgagactcttgggtaccgttggtgagcct
ataaatccagaggcatggatgtggtattaccagacagtcggaaacgagagatctcccatc
gtggatacatggtggcaaacagaaactggagggcacatgataacaacagttccaggggct
cagactgcaaaacccggctcagctggaatgccacttccgggtatttttgctgaaatcgtt
gatacagagggaaatcctataaatgatccaaataagggcggcttgcttgttataacaaaa
ccatggccttctatgttgcggactgtttggggtgatgataacagatttattgagacctat
tggaagaaatttaagaacaaaggatattactttgccggtgatggtgcaaggaaagatgag
gatggctacttctggattatgggtagggttgatgatgtcctgaacgtttctgggcatagg
ataggaacgatggaagttgagagtgctttagtctcacataggtatgtggctgaggctgct
gtagttggtaggccggatgatatcacaggtgaggctattgtagcattcgttgtacttaaa
gagggtgttgataagacgcatcacgatgagcttgtaagagagctaagagagcatgtgcaa
aaggaaataggtcctatagcaagacctcaggagataatatttacagacacccttccaaaa
acccgttcaggaaaaatcatgagaaggctgcttaaggatatagcatctggtaagaagata
gagcaggatatatctacacttgaggatgcttctgtgttggataaacttgctgaactcagg
gataaaatggaagaggagatgaacaaaaacggaaactctaaaaaatag

DBGET integrated database retrieval system