KEGG   Hippea maritima: Hipma_0588Help
Entry
Hipma_0588        CDS       T01456                                 

Definition
(GenBank) Pyruvate synthase (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_0588
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0588
   00020 Citrate cycle (TCA cycle)
    Hipma_0588
   00620 Pyruvate metabolism
    Hipma_0588
   00640 Propanoate metabolism
    Hipma_0588
   00650 Butanoate metabolism
    Hipma_0588
  Energy metabolism
   00680 Methane metabolism
    Hipma_0588
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hipma_0588
Enzymes [BR:hmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hipma_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(596331..597281)
Genome map
AA seq 316 aa AA seqDB search
MALLNDLAKKKEGLVSGHRLCPGCTHSVIARQVFAAAETDKYDIVVAAATGCFEVSTGLY
PYTSWNVPWIHTAFENAASTISGVEAAYKALKKKGKVKKDIRFIAFASDGGTYDIGLQAL
SGAIERGHQFLYICNDNNAYQNTGNQRSSATPFGGSTTTSPNGKVKFGKEQPRKDIVSVL
EGHHMEYIAQASPSNWRDLMNKVKKALDVDGPTYINVIEPCTTGWGFPSNKAIEIAQLAV
DTCVWPLYEVIKGKVVINYKPKKKLPVEEYLKPQRRFAHLFKKGNEYLIEEFQKQVDRHW
EWLLKREECGISYFED
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctctgttaaatgatttagcaaagaaaaaggaaggccttgtaagtggccatagattg
tgtccaggttgtacgcactcagttatagcaagacaggtatttgcggcagctgagacagac
aaatacgatatagttgttgcggcagctaccggttgttttgaggtttcaactggtctttat
ccatatacaagctggaatgtgccgtggattcatacagcctttgagaatgctgcaagtaca
atatccggcgttgaagccgcctataaagccctaaagaaaaagggtaaagtcaaaaaagat
attaggtttatagcatttgcaagtgatggaggtacatacgacatagggttgcaggcactt
tcgggtgccattgaaagagggcatcaatttctttatatctgtaatgataacaacgcatat
cagaatacaggaaaccagcgctcttctgcaactccatttggaggctctacaacaacatca
ccaaacggtaaagttaaatttggaaaggaacaaccaagaaaagacattgtgagcgtttta
gaaggccatcacatggaatacatcgcacaggcttcaccctccaattggagagatctaatg
aataaggtcaaaaaagcacttgatgttgatggcccaacatacataaacgttattgagcca
tgtaccacgggctggggtttcccatctaacaaagccattgaaatagcacaactggccgtc
gatacatgtgtatggccgttgtatgaggttatcaaaggaaaggttgttatcaactacaaa
ccaaagaaaaaactgcctgttgaggaatacctaaaaccacaaagaaggtttgcgcacctc
ttcaagaaaggcaatgagtatttaattgaagagttccaaaagcaggttgatagacactgg
gagtggctcttaaaaagagaagagtgtggtatatcctatttcgaagactaa

DBGET integrated database retrieval system