KEGG   Hippea maritima: Hipma_0590Help
Entry
Hipma_0590        CDS       T01456                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_0590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0590
   00020 Citrate cycle (TCA cycle)
    Hipma_0590
   00620 Pyruvate metabolism
    Hipma_0590
   00640 Propanoate metabolism
    Hipma_0590
   00650 Butanoate metabolism
    Hipma_0590
  Energy metabolism
   00680 Methane metabolism
    Hipma_0590
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hipma_0590
Enzymes [BR:hmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hipma_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(598494..598838)
Genome map
AA seq 114 aa AA seqDB search
MAEKLLKWDEVLIGATIKDPGNSKNYETGSWRVERPVWNPDTCIQCMFCWVYCPDSSILV
DENGKMAGIDYDHCKGCGICVEQCPSKPKSLQMVLEAQAKGKTVEELRKEVFSK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaattgctaaaatgggatgaagtacttattggcgcaaccataaaggaccct
ggtaattctaaaaactacgaaactggctcatggagagttgagcgcccagtctggaatcca
gacacttgcattcaatgtatgttttgctgggtttattgtcccgatagctctattcttgta
gatgaaaatggaaagatggctggtatagattatgaccattgcaaaggttgtggaatctgt
gttgagcaatgcccaagtaaaccaaaatctctccagatggttttagaggcccaggcaaaa
ggtaaaacagtggaagagttaagaaaagaagtcttttccaagtaa

DBGET integrated database retrieval system