KEGG   Hippea maritima: Hipma_0590Help
Entry
Hipma_0590        CDS       T01456                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_0590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0590
   00020 Citrate cycle (TCA cycle)
    Hipma_0590
   00620 Pyruvate metabolism
    Hipma_0590
   00640 Propanoate metabolism
    Hipma_0590
   00650 Butanoate metabolism
    Hipma_0590
  Energy metabolism
   00680 Methane metabolism
    Hipma_0590
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hipma_0590
Enzymes [BR:hmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hipma_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(598494..598838)
Genome map
AA seq 114 aa AA seqDB search
MAEKLLKWDEVLIGATIKDPGNSKNYETGSWRVERPVWNPDTCIQCMFCWVYCPDSSILV
DENGKMAGIDYDHCKGCGICVEQCPSKPKSLQMVLEAQAKGKTVEELRKEVFSK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaattgctaaaatgggatgaagtacttattggcgcaaccataaaggaccct
ggtaattctaaaaactacgaaactggctcatggagagttgagcgcccagtctggaatcca
gacacttgcattcaatgtatgttttgctgggtttattgtcccgatagctctattcttgta
gatgaaaatggaaagatggctggtatagattatgaccattgcaaaggttgtggaatctgt
gttgagcaatgcccaagtaaaccaaaatctctccagatggttttagaggcccaggcaaaa
ggtaaaacagtggaagagttaagaaaagaagtcttttccaagtaa

DBGET integrated database retrieval system