KEGG   Hippea maritima: Hipma_0592Help
Entry
Hipma_0592        CDS       T01456                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hmr  Hippea maritima
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hipma_0592
DNA repair and recombination proteins [BR:hmr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Hipma_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(599440..600045)
Genome map
AA seq 201 aa AA seqDB search
MKNAHLKLLDELSLYLKNIPGIGEKNASKYAFWLAEHKDKANSISKLLKEISEKVKSCRL
CYNLTANENGICDICSDKSRDHETVCVVETIENLLEIETANVYNGLYFILGGVISPIYGI
DSIIKRIDYLVSRILKEQKKELILVISPTTEGELTMQYIKEKLKPSNIKITKVAIGVPAG
ADINYINKKTLIEAFKMRTVA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgctcatttgaaattattggatgagttgagcttatatttaaaaaatatacca
ggcataggagagaaaaacgcttcaaagtatgctttctggttagcagaacacaaagataaa
gcaaactctatatctaaactactaaaagaaatatctgaaaaggtcaaatcatgcagactt
tgttataatctaaccgcaaacgaaaatggtatatgtgatatatgttccgataaatcgcgc
gaccatgaaaccgtatgcgtagttgaaactattgaaaatttacttgaaatagagacggca
aatgtatataatggactttactttatactggggggagttatttcacctatatacggaata
gatagcattataaaacgtatagattatttagtaagcagaatactaaaagaacaaaagaaa
gaactcatcttggtaatcagtcctacaacagagggggagttgactatgcaatacataaaa
gaaaaactgaaaccgtccaatattaaaatcacaaaggttgcaataggtgtgcctgctggt
gcggacataaactatataaacaaaaaaacactcatagaagcattcaaaatgagaactgtt
gcataa

DBGET integrated database retrieval system