KEGG   Hippea maritima: Hipma_0622Help
Entry
Hipma_0622        CDS       T01456                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hmr  Hippea maritima
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hipma_0622
Enzymes [BR:hmr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Hipma_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
627435..628760
Genome map
AA seq 441 aa AA seqDB search
MKAIVVGAGISGASAAFLLKKLNYDVLVIEKLRIGGKAYSVAQNGYVIETGPNGFLENKK
EILNLVYESGFEKELIEANKESQRRFIYSKNKLWELKNNPISLLFNGFFSIGGILSFLEE
PFVRPLLEDETVEDFVLRRFSKEMLNKLIGPMVCGVFAGDPSRMSMESNFPRIKEVEKEH
GSLIRGLIDLMIKRKARASSAKGSLSANLLSFKNGVLSFIEHLLNGVDVVFDEIGEITKN
EKFYLKGKTANYSADIIVFAIPSYALTKVFWDADREFAKAVSSVEYAPMSVLAFGFNKEG
LPDIVNSFGYLFNLEEIEDIIGVLFDSSIFKGRAYKDKMLIRCMVGGALRKNSPFKSNLF
EIGIKELQRSASIFLPPEFFYKLVHPKAIPQYSLGHKNVLNSVKDFEDKNKGLFITGNAF
WGISLNDCVKASYDLIERVGG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatagttgttggagccggcataagcggtgcttcagccgctttccttttgaag
aagttaaactacgatgttctggttatagaaaagctgagaatcggcggcaaggcctacagc
gttgcgcaaaatggctatgttatagagacaggtccaaatggttttttggaaaacaaaaag
gaaattttgaatcttgtttatgaaagtggctttgagaaagagttaatcgaggcaaacaaa
gaatcacaaagaagatttatctactcgaaaaataaactgtgggagcttaaaaataatcct
atatccttgttgtttaacggctttttctctataggaggcatattatcattcttggaggag
ccatttgttaggccgttgcttgaggatgaaaccgttgaggattttgttttgagaagattt
tcaaaagagatgctgaataagcttataggacctatggtttgtggcgtttttgcaggagac
ccctcacgcatgagtatggagtcaaactttccgaggataaaggaggtagaaaaagagcat
ggttctttaattagaggtctcatagatttaatgataaaaaggaaagccagggcttcttcg
gcgaagggaagcctatctgcgaatctcttgtcatttaaaaacggcgttttgagttttatt
gaacaccttttgaacggtgttgatgttgttttcgatgagataggggaaataaccaaaaat
gaaaaattttatctaaaaggaaaaacggctaactattctgcagatattattgtatttgct
attccaagttatgccttaacgaaagttttctgggatgcagaccgtgaatttgcaaaagct
gtttcatctgtagaatatgcgcctatgtctgttttagcttttgggtttaataaggaaggg
ttgcccgatattgttaattcttttggttatctttttaatttagaagaaatagaggatatc
ataggtgttctttttgatagtagtatatttaagggcagggcgtataaggataagatgctt
attaggtgtatggttggaggagctttaagaaaaaatagtccttttaaatctaatttattt
gaaataggcataaaagaacttcaaaggagtgcctctatttttttaccgcctgagtttttt
tataaacttgtccatcctaaggctataccacaatactctcttggtcataaaaatgtttta
aatagcgtgaaagacttcgaggataaaaataaagggttgtttataacaggtaatgctttt
tggggtataagcttaaacgactgcgttaaggcctcttacgatttgattgaaagggtaggg
ggttaa

DBGET integrated database retrieval system