KEGG   Hippea maritima: Hipma_0658Help
Entry
Hipma_0658        CDS       T01456                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hmr  Hippea maritima
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hipma_0658
Enzymes [BR:hmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Hipma_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656307..658193
Genome map
AA seq 628 aa AA seqDB search
MSGKKERLQYKDYFRHNAKIIRWCTLEHCKFRAEERNRAIRFIYIRGMGINPQRYSKAKK
NCVRKMQTKSIKGTIASVIYLNDDNAFSILSVETKQGKIKAKGVFPDLKSIGKEKAKELE
CELVGSWKKDLRWGYEFVFSNGRILNSDGLFFFLTKIVKGIGEKLARELINHYGEQQLTY
ILDNEPDTLTEFKGIKEKKLAKILESWNKYRQLKQLSEFFTRYGVNATGNLILRIYNTFK
DRTDFDLMLELSRNPYILTEVRGIGFKTADKIALQMGVAEDSPERVSALLDYILASESSD
NGHTFLTYNQIYEKASEYIYKEDDNKGIEDIKPIIDTVIRSNEEKYYYDTKKVAFKGHRV
KEDYIETEMRKRLSRRFFAVLSEQEAEEFIRKQEQRLGFRFSDEQKKAIKTITTTGTNTF
ILCGYAGTGKSTISKVILDFYSQFIPKEKITCCAFTGMASKRIREVTGYKSSTIHSLLKY
KGDSFEYNQNNPLPYDVILLDEASMVNLDIFYHLLRAVKRDAVFIMVGDDAQLPPIGAGN
VFNDLLHKDWIPKVKLTKIYRQSSDSVITYFASYIRQGRVPQGYIGRYRDWYFKEMEIKN
YFQLKKTLSNKELAELRESYLYPFSLAV
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcaaaaaggaaagattgcaatacaaagactatttcaggcataacgctaaaatc
attagatggtgtacactggaacattgcaagtttagagcagaggaaagaaatagggctata
cggttcatatacattagaggaatgggaatcaatcctcaacgctattctaaagcaaagaaa
aactgcgtaaggaaaatgcaaactaagtccattaaaggcactatagccagcgtcatatat
ttaaacgacgacaacgccttctccatcctctccgttgagaccaagcagggcaagataaaa
gccaagggcgtattcccagacctcaaatccatcggcaaggagaaggctaaagagcttgag
tgcgagcttgtaggttcctggaaaaaagatctcagatggggctatgagtttgtcttctct
aacggcagaatcctcaacagcgacggcttgttcttcttcctgacaaagatagtaaagggc
ataggcgagaagttggcaagggagcttatcaaccactacggcgagcagcagctaacctac
atccttgacaacgagcccgacacactcaccgagttcaaaggcataaaagagaaaaagcta
gccaagatacttgagtcttggaacaaatataggcagttaaagcagttgagcgagttcttt
acccgctacggcgtcaatgcaacaggcaatcttatcctacgcatatataacacctttaaa
gatagaacagattttgacttaatgcttgagctctcccgcaacccctacatccttaccgaa
gtcagaggcataggctttaagactgccgataagatagctctccagatgggtgttgccgag
gacagcccggagagagttagcgccttgcttgactatatattggcttccgagtccagcgac
aatggacacacgttcttaacctacaaccagatctacgagaaagccagcgaatacatatac
aaagaagacgacaataagggcattgaggacatcaagcccataatagatacagttatccgc
tccaatgaagaaaagtattattacgacactaaaaaggtagcctttaaagggcatagggta
aaggaagactacattgagaccgagatgagaaaaaggctatcccgcaggttctttgcggtt
ctatcagaacaggaggctgaggagtttattagaaagcaggagcagaggttaggctttagg
ttttctgatgaacagaaaaaggcaattaagacaattaccacaacgggcacaaacaccttt
atcttatgcggttacgctggaacgggtaagtctacaatatcaaaagtaattcttgacttt
tacagtcaatttataccaaaggagaaaataacctgctgtgcctttacgggtatggcttca
aagagaattagagaggtaacaggttataaatcttcgactatacactccttgcttaaatac
aagggagatagtttcgagtacaaccaaaacaaccctctaccttatgacgtcatcttgctt
gatgaagcaagtatggtgaacttggatatattctaccacctattgagagcagtcaagaga
gatgccgtcttcattatggtgggagacgatgctcagcttccgcctatcggtgccggcaat
gttttcaacgacttacttcacaaagactggataccaaaggtaaaactcacgaaaatctac
agacagagctctgacagcgtaataacctactttgcaagctacataaggcagggtagggtg
ccgcaggggtatatcggcaggtatagagactggtattttaaggagatggagataaaaaac
tatttccagctaaagaaaaccttatcaaacaaggaacttgcagaattgagagagtcgtat
ttgtatcctttttctttggctgtatag

DBGET integrated database retrieval system