KEGG   Hippea maritima: Hipma_0658Help
Entry
Hipma_0658        CDS       T01456                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hmr  Hippea maritima
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hmr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656307..658193
Genome map
AA seq 628 aa AA seqDB search
MSGKKERLQYKDYFRHNAKIIRWCTLEHCKFRAEERNRAIRFIYIRGMGINPQRYSKAKK
NCVRKMQTKSIKGTIASVIYLNDDNAFSILSVETKQGKIKAKGVFPDLKSIGKEKAKELE
CELVGSWKKDLRWGYEFVFSNGRILNSDGLFFFLTKIVKGIGEKLARELINHYGEQQLTY
ILDNEPDTLTEFKGIKEKKLAKILESWNKYRQLKQLSEFFTRYGVNATGNLILRIYNTFK
DRTDFDLMLELSRNPYILTEVRGIGFKTADKIALQMGVAEDSPERVSALLDYILASESSD
NGHTFLTYNQIYEKASEYIYKEDDNKGIEDIKPIIDTVIRSNEEKYYYDTKKVAFKGHRV
KEDYIETEMRKRLSRRFFAVLSEQEAEEFIRKQEQRLGFRFSDEQKKAIKTITTTGTNTF
ILCGYAGTGKSTISKVILDFYSQFIPKEKITCCAFTGMASKRIREVTGYKSSTIHSLLKY
KGDSFEYNQNNPLPYDVILLDEASMVNLDIFYHLLRAVKRDAVFIMVGDDAQLPPIGAGN
VFNDLLHKDWIPKVKLTKIYRQSSDSVITYFASYIRQGRVPQGYIGRYRDWYFKEMEIKN
YFQLKKTLSNKELAELRESYLYPFSLAV
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcaaaaaggaaagattgcaatacaaagactatttcaggcataacgctaaaatc
attagatggtgtacactggaacattgcaagtttagagcagaggaaagaaatagggctata
cggttcatatacattagaggaatgggaatcaatcctcaacgctattctaaagcaaagaaa
aactgcgtaaggaaaatgcaaactaagtccattaaaggcactatagccagcgtcatatat
ttaaacgacgacaacgccttctccatcctctccgttgagaccaagcagggcaagataaaa
gccaagggcgtattcccagacctcaaatccatcggcaaggagaaggctaaagagcttgag
tgcgagcttgtaggttcctggaaaaaagatctcagatggggctatgagtttgtcttctct
aacggcagaatcctcaacagcgacggcttgttcttcttcctgacaaagatagtaaagggc
ataggcgagaagttggcaagggagcttatcaaccactacggcgagcagcagctaacctac
atccttgacaacgagcccgacacactcaccgagttcaaaggcataaaagagaaaaagcta
gccaagatacttgagtcttggaacaaatataggcagttaaagcagttgagcgagttcttt
acccgctacggcgtcaatgcaacaggcaatcttatcctacgcatatataacacctttaaa
gatagaacagattttgacttaatgcttgagctctcccgcaacccctacatccttaccgaa
gtcagaggcataggctttaagactgccgataagatagctctccagatgggtgttgccgag
gacagcccggagagagttagcgccttgcttgactatatattggcttccgagtccagcgac
aatggacacacgttcttaacctacaaccagatctacgagaaagccagcgaatacatatac
aaagaagacgacaataagggcattgaggacatcaagcccataatagatacagttatccgc
tccaatgaagaaaagtattattacgacactaaaaaggtagcctttaaagggcatagggta
aaggaagactacattgagaccgagatgagaaaaaggctatcccgcaggttctttgcggtt
ctatcagaacaggaggctgaggagtttattagaaagcaggagcagaggttaggctttagg
ttttctgatgaacagaaaaaggcaattaagacaattaccacaacgggcacaaacaccttt
atcttatgcggttacgctggaacgggtaagtctacaatatcaaaagtaattcttgacttt
tacagtcaatttataccaaaggagaaaataacctgctgtgcctttacgggtatggcttca
aagagaattagagaggtaacaggttataaatcttcgactatacactccttgcttaaatac
aagggagatagtttcgagtacaaccaaaacaaccctctaccttatgacgtcatcttgctt
gatgaagcaagtatggtgaacttggatatattctaccacctattgagagcagtcaagaga
gatgccgtcttcattatggtgggagacgatgctcagcttccgcctatcggtgccggcaat
gttttcaacgacttacttcacaaagactggataccaaaggtaaaactcacgaaaatctac
agacagagctctgacagcgtaataacctactttgcaagctacataaggcagggtagggtg
ccgcaggggtatatcggcaggtatagagactggtattttaaggagatggagataaaaaac
tatttccagctaaagaaaaccttatcaaacaaggaacttgcagaattgagagagtcgtat
ttgtatcctttttctttggctgtatag

DBGET integrated database retrieval system