KEGG   Hippea maritima: Hipma_0795Help
Entry
Hipma_0795        CDS       T01456                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_0795
   01230 Biosynthesis of amino acids
    Hipma_0795
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0795
   00030 Pentose phosphate pathway
    Hipma_0795
   00051 Fructose and mannose metabolism
    Hipma_0795
   00052 Galactose metabolism
    Hipma_0795
  Energy metabolism
   00680 Methane metabolism
    Hipma_0795
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Hipma_0795
Enzymes [BR:hmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Hipma_0795
Protein phosphatases and associated proteins [BR:hmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Hipma_0795
Messenger RNA biogenesis [BR:hmr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Hipma_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786686..787642
Genome map
AA seq 318 aa AA seqDB search
MRIGIFTSGGDAAGMNPALKAFVELTLEKGWEPFFVYNGLEGLIDGKIRKASYQDVAGIL
HKGGTIIKSSRSKRFYDYEYRKRAYDNLKKHDIEKIIVLGGDGSFRAMDVFFEEFGVSFA
GIPVTIDNDIYGTDYCLGVDTALNVIRMLLDNIRDTASSFGRAFVVETMGRECGYLALVS
SITSGAEICVIPELDVDFVSLKRRLSKELASGRGYVLAVVAEGSNKTQQVADFLKNDLGM
ETRITTLGHVQRGGNPTVFDRLMAYKFIEFALENLRENIHHMVGFKDEKFYLLPIKDVVS
HKYKINDFLLKLGRRMTR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaggattggaatctttacatccggaggggatgctgccggcatgaatccagccttgaag
gcgtttgttgagttaaccctggaaaaaggatgggagccgttttttgtgtataatggcttg
gaaggtttaatagatggaaaaatcagaaaggcaagctatcaggatgttgcaggtattctc
cataagggaggaactatcataaaatcttcccgttcaaaacgtttttatgactatgaatac
agaaaaagagcatacgataatctaaagaaacacgacatagagaagataatagttcttggt
ggtgatggttcttttagggcaatggatgtattttttgaggagtttggtgttagttttgca
gggatccctgttacgatagacaacgatatatacggcacggattactgtttaggtgtagac
acagccttaaatgttataaggatgttgcttgataacataagggacactgcatcgtcattt
ggaagggcttttgttgttgagactatgggtagagagtgtggctatctggctttggtaagc
tcaattacaagcggagcagagatatgcgttatacctgagcttgatgttgactttgtatcc
ttgaagaggaggttatccaaagagcttgcaagcggaaggggttatgtattggccgttgtg
gctgaaggttcaaataaaacacagcaggttgccgattttttgaaaaatgatcttggcatg
gaaacccgcatcacaacgctcggtcatgtccaaagaggcggtaatcctacagtctttgat
aggcttatggcttataaatttattgagtttgcccttgagaatctgagagaaaacattcat
cacatggttggctttaaagacgaaaaattctatcttttgcctataaaagatgttgtatcg
cataagtataaaataaacgattttcttttgaagcttggcaggagaatgactcggtag

DBGET integrated database retrieval system