KEGG   Hippea maritima: Hipma_0796Help
Entry
Hipma_0796        CDS       T01456                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hmr  Hippea maritima
Pathway
hmr00010  Glycolysis / Gluconeogenesis
hmr00020  Citrate cycle (TCA cycle)
hmr00620  Pyruvate metabolism
hmr00633  Nitrotoluene degradation
hmr00640  Propanoate metabolism
hmr00650  Butanoate metabolism
hmr00680  Methane metabolism
hmr01100  Metabolic pathways
hmr01120  Microbial metabolism in diverse environments
hmr01130  Biosynthesis of antibiotics
hmr01200  Carbon metabolism
Module
hmr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0796
   00020 Citrate cycle (TCA cycle)
    Hipma_0796
   00620 Pyruvate metabolism
    Hipma_0796
   00640 Propanoate metabolism
    Hipma_0796
   00650 Butanoate metabolism
    Hipma_0796
  Energy metabolism
   00680 Methane metabolism
    Hipma_0796
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hipma_0796
Enzymes [BR:hmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hipma_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AEA33766
UniProt: F2LVI2
Position
787704..788240
Genome map
AA seq 178 aa AA seqDB search
MKEIGLHGRGGQGVVMAGELLANIYFFEGYNVQFMPSYGAERRGSPSNAYVRIDKERKIL
TRYSITMPDAVVVFNLTLLTNITLKNGGLALINSAEDIKKTQNNTKIFVVDANSIALENG
LGTPAMPLVNTALLGAYCKASGEFSFDTLKRVYEDKMGKRARFNIEAAEKAYESVREI
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagattggtttacacggcaggggaggccaaggcgtagtaatggctggagaacta
cttgccaatatatacttttttgaggggtataatgttcaatttatgccttcatacggtgca
gaaagaagaggttccccatcaaatgcatatgtcagaatagataaagagaggaaaatttta
accagatattctataacgatgccagatgccgttgtggtttttaatctaacgttattgact
aacataaccctaaagaatggcggtttggctctaataaactcagcagaagatatcaaaaaa
acgcagaacaataccaaaatattcgtggttgatgcaaacagtatagctcttgaaaatggg
cttggcaccccagctatgccacttgttaatacggctttacttggtgcctattgcaaggca
tctggtgaattttcctttgatacgctaaaaagggtttatgaggacaaaatgggcaaaaga
gctcgttttaatatagaagctgcagaaaaagcctatgaaagtgtgagggagatatga

DBGET integrated database retrieval system