KEGG   Hippea maritima: Hipma_0798Help
Entry
Hipma_0798        CDS       T01456                                 

Definition
(GenBank) Pyruvate synthase (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_0798
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0798
   00020 Citrate cycle (TCA cycle)
    Hipma_0798
   00620 Pyruvate metabolism
    Hipma_0798
   00640 Propanoate metabolism
    Hipma_0798
   00650 Butanoate metabolism
    Hipma_0798
  Energy metabolism
   00680 Methane metabolism
    Hipma_0798
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hipma_0798
Enzymes [BR:hmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hipma_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
789370..790242
Genome map
AA seq 290 aa AA seqDB search
MIIPTQEIMQPNHLACPGCGAALAMRYALKALGRKTIIVIPACCWTVINGPWGKNYAGVP
VFHTAFETTAAVAAGIRTSLEAQGKNDITVMGWAGDGGTFDIGLQALSGAAERNDDIIYV
CYDNEAYMNTGIQRSSATPVGAETTTTPAPLLKDRPKKDLMEIVAAHSVPYIASATIAYP
TDFIKKFEKAKSKRGFKLIHIFSPCPPGHKFAENKTIDVSKLAVETGIFPLYEIEDGVYK
INKKPKFRPIEEYLSLQGRFKNIPKEQMRAIEEAIQMKWQRLQAKAEYLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgataataccaacgcaagagataatgcagcccaaccacctggcatgcccagggtgtggc
gctgctttggctatgagatacgccttaaaggctttgggtagaaaaacaatcatagtgatt
ccggcatgttgctggactgttataaacgggccatggggtaagaattacgctggagttccc
gtgttccatacggcatttgaaactactgcagccgtcgcagcaggcataagaacatccctt
gaagctcagggtaagaatgacattacggtgatgggatgggctggtgatggaggaacattt
gatataggactgcaagccttaagcggtgcagcagaaagaaacgatgatattatctatgtg
tgctatgataacgaggcatacatgaacacgggtattcagaggagctccgcaacgccggtt
ggtgccgagacaaccacaacgccggctccgcttttaaaggatagacccaaaaaggactta
atggaaattgttgcagcacactctgttccttatatagcctctgccacgatagcttatcca
acagattttataaagaaatttgaaaaagcaaaaagcaaaagaggttttaagcttattcac
atatttagcccatgccccccaggacataaatttgcagagaataaaactatagatgtatca
aagttggctgttgagactggaatttttccactctatgagatagaagacggcgtttataag
ataaataaaaaaccaaaatttagacctatcgaggaatatttaagcctccagggtagattt
aagaatatcccaaaggaacagatgagggcgattgaggaggctatacaaatgaaatggcag
agattgcaggccaaagctgaatacctcaagtag

DBGET integrated database retrieval system